Reactivity | HuSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Concentration | 0.5 mg/ml |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of PMP22. Peptide sequence: QWIVGNGHATDLWQNCSTSSSGNVHHCFSSSPNEWLQSVQATMILSIIFS The peptide sequence for this immunogen was taken from within the described region. |
Clonality | Polyclonal |
Host | Rabbit |
Gene | PMP22 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS, 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Concentration | 0.5 mg/ml |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PMP22 Antibody (NBP2-86749)Find related products by research area.
|
PMP22 Antibodies Assist in PNS Myelin Repair Research Novus Biologicals recently added a new PMP22 antibody, conjugated to Biotin, to our antibody database. PMP22 (Peripheral Myelin Protein 22) is important to the structure of the myelin sheath in peripheral nerves, and is encoded by the PMP22 gene.Th... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | PMP22 |