![Western Blot: PLA2G6 Antibody [NBP1-81586] - Effects of APPWT and APPOSK overexpression on the levels of the major phospholipase A2s in the brains of old mice. Cerebrum samples from non-Tg, APPWT and APPOSK were lyophilized, pulverized, and homogenized in NP40 buffer using a cooled bead beater. Total protein concentrations from NP40 supernatants were estimated by BCA protein assay. Representative Western blots using multiple antibodies against PLA2. Image collected and cropped by CiteAb from the following publication (//actaneurocomms.biomedcentral.com/articles/10.1186/s40478-017-0460-6), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/PLA2G6-Antibody-Western-Blot-NBP1-81586-img0015.jpg "Western Blot: PLA2G6 Antibody [NBP1-81586] - Effects of APPWT and APPOSK overexpression on the levels of the major phospholipase A2s in the brains of old mice. Cerebrum samples from non-Tg, APPWT and APPOSK were lyophilized, pulverized, and homogenized in NP40 buffer using a cooled bead beater. Total protein concentrations from NP40 supernatants were estimated by BCA protein assay. Representative Western blots using multiple antibodies against PLA2. Image collected and cropped by CiteAb from the following publication (//actaneurocomms.biomedcentral.com/articles/10.1186/s40478-017-0460-6), licensed under a CC-BY license.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRIISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMG |
| Predicted Species | Mouse (91%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PLA2G6 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot PLA2G2A Antibody [Unconjugated]](https://images.novusbio.com/images2/PLA2G2A_AF4925_Western_Blot_10430.jpg)
![Immunohistochemistry PLA2G2A Antibody [Unconjugated]](https://images.novusbio.com/images2/PLA2G2A_AF4925_Immunohistochemistry_10959.jpg)
![Simple Western PLA2G2A Antibody [Unconjugated]](https://images.novusbio.com/images2/PLA2G2A_AF4925_Simple_Western_17643.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PLA2G6 |
![Immunocytochemistry/Immunofluorescence: PLA2G6 Antibody [NBP1-81586] - Staining of human cell line A-431 shows localization to microtubule organizing center. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/PLA2G6-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81586-img0011.jpg "Immunocytochemistry/Immunofluorescence: PLA2G6 Antibody [NBP1-81586] - Staining of human cell line A-431 shows localization to microtubule organizing center. Antibody staining is shown in green.")
![Immunohistochemistry: PLA2G6 Antibody [NBP1-81586] - Non-Tg mouse brains were dissected, fixed in 4% paraformaldehyde, cryoprotected, frozen, & sectioned coronally (8 um sections). Representative immunofluorescence images taken from brain coronal sections (Bregma -2) using phospho-cPLA2 (yellow) antibody and DAPI (blue) (a) or and iPLA2 (yellow) and NeuN (red) antibodies (b). Images show a whole hemibrain section using a 20x objective on a Nikon A1R VAAS inverted confocal (left panels). NeuN and iPLA2 co-localize within the perinucleus of pyramidal neurons (PN, white arrows), but not within the perinucleus of interneurons (IN). iPLA2 staining is also observed within pyramidal dendritic arborization (right panels) Image collected and cropped by CiteAb from the following publication (//actaneurocomms.biomedcentral.com/articles/10.1186/s40478-017-0460-6), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/PLA2G6-Antibody-Immunohistochemistry-NBP1-81586-img0016.jpg "Immunohistochemistry: PLA2G6 Antibody [NBP1-81586] - Non-Tg mouse brains were dissected, fixed in 4% paraformaldehyde, cryoprotected, frozen, & sectioned coronally (8 um sections). Representative immunofluorescence images taken from brain coronal sections (Bregma -2) using phospho-cPLA2 (yellow) antibody and DAPI (blue) (a) or and iPLA2 (yellow) and NeuN (red) antibodies (b). Images show a whole hemibrain section using a 20x objective on a Nikon A1R VAAS inverted confocal (left panels). NeuN and iPLA2 co-localize within the perinucleus of pyramidal neurons (PN, white arrows), but not within the perinucleus of interneurons (IN). iPLA2 staining is also observed within pyramidal dendritic arborization (right panels) Image collected and cropped by CiteAb from the following publication (//actaneurocomms.biomedcentral.com/articles/10.1186/s40478-017-0460-6), licensed under a CC-BY license.")
![Western Blot: PLA2G6 Antibody [NBP1-81586] - Analysis in human cell line HEL.](http://images.novusbio.com/fullsize/PLA2G6-Antibody-Western-Blot-NBP1-81586-img0013.jpg "Western Blot: PLA2G6 Antibody [NBP1-81586] - Analysis in human cell line HEL.")
![Western Blot: PLA2G6 Antibody [NBP1-81586] - Analysis in control (vector only transfected HEK293T lysate) and PLA2G6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/PLA2G6-Antibody-Western-Blot-NBP1-81586-img0014.jpg "Western Blot: PLA2G6 Antibody [NBP1-81586] - Analysis in control (vector only transfected HEK293T lysate) and PLA2G6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Simple Western 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/1433_zeta_MAB2669_Simple_Western_16526.jpg)
![Western Blot 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/14-3-3_zeta_MAB2669_Western_Blot_12700.jpg)
![Immunohistochemistry 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/14-3-3_zeta_MAB2669_Immunohistochemistry_12730.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunohistochemistry Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Endorepellin_AF2364_Immunohistochemistry_6744.jpg)
![SDS-PAGE IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images2/IL-1_beta_201-LB_304.jpg)
![Bioactivity IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images2/IL-1_beta_201-LB_306.jpg)
![SEC-MALS IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images/201-lb_recombinant-human-il-1-beta-il-1f2-protein-sec-mals-123202491556.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")