![Western Blot: PIAS2 Antibody (1F7) [H00009063-M01] - Analysis of PIAS2 over-expressed 293 cell line, cotransfected with PIAS2 Validated Chimera RNAi ( Cat # H00009063-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PIAS2 monoclonal antibody (M01), clone 1F7 (Cat # H00009063-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://images.novusbio.com/fullsize/PIAS2-Antibody-1F7-Western-Blot-H00009063-M01-img0007.jpg "Western Blot: PIAS2 Antibody (1F7) [H00009063-M01] - Analysis of PIAS2 over-expressed 293 cell line, cotransfected with PIAS2 Validated Chimera RNAi ( Cat # H00009063-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PIAS2 monoclonal antibody (M01), clone 1F7 (Cat # H00009063-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, Func, ICC/IF, KD |
| Clone | 1F7 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | PIAS2 (NP_004662, 385 a.a. ~ 473 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQEDGSWCPMRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLT |
| Localization | Nuclear |
| Specificity | PIAS2 - protein inhibitor of activated STAT, 2 |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | PIAS2 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. Has also been used for RNAi validation and immunofluorescence. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for PIAS2 Antibody (H00009063-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: PIAS2 Antibody (1F7) [H00009063-M01] - Analysis of monoclonal antibody to PIAS2 on HeLa cell . Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/PIAS2-Antibody-1F7-Immunocytochemistry-Immunofluorescence-H00009063-M01-img0006.jpg "Immunocytochemistry/Immunofluorescence: PIAS2 Antibody (1F7) [H00009063-M01] - Analysis of monoclonal antibody to PIAS2 on HeLa cell . Antibody concentration 10 ug/ml.")
![Proximity Ligation Assay: PIAS2 Antibody (1F7) [H00009063-M01] - Analysis of protein-protein interactions between TP53 and PIAS2. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-PIAS2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).](http://images.novusbio.com/fullsize/PIAS2-Antibody-1F7-Proximity-Ligation-Assay-H00009063-M01-img0004.jpg "Proximity Ligation Assay: PIAS2 Antibody (1F7) [H00009063-M01] - Analysis of protein-protein interactions between TP53 and PIAS2. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-PIAS2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).")
![Sandwich ELISA: PIAS2 Antibody (1F7) [H00009063-M01] - Detection limit for recombinant GST tagged PIAS2 is approximately 0.3ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/PIAS2-Antibody-1F7-Sandwich-ELISA-H00009063-M01-img0008.jpg "Sandwich ELISA: PIAS2 Antibody (1F7) [H00009063-M01] - Detection limit for recombinant GST tagged PIAS2 is approximately 0.3ng/ml as a capture antibody.")
![N/A CD46 Antibody (344519) [Unconjugated]](https://images.novusbio.com/images/antibody/mab2005_human-cd46-mab-clone-344519-209202413163..jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
