![Immunocytochemistry/Immunofluorescence: ATF6 beta Antibody (4D10) [H00001388-M02] - Analysis of monoclonal antibody to ATF6B on HeLa cell . Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/ATF6-beta-Antibody-4D10-Immunocytochemistry-Immunofluorescence-H00001388-M02-img0003.jpg "Immunocytochemistry/Immunofluorescence: ATF6 beta Antibody (4D10) [H00001388-M02] - Analysis of monoclonal antibody to ATF6B on HeLa cell . Antibody concentration 10 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 4D10 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | CREBL1 (NP_004372.3, 2 a.a. ~ 88 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDGSSLDVGMDVSPSEPPWELLPIFPDLQVK |
| Specificity | CREBL1 - cAMP responsive element binding protein-like 1 (4D10) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ATF6B |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Antibody reactivity against recombinant protein for WB. It has been used for ELISA. |
||
| Control |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Sandwich ELISA: ATF6 beta Antibody (4D10) [H00001388-M02] - Detection limit for recombinant GST tagged CREBL1 is approximately 1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/ATF6-beta-Antibody-4D10-Sandwich-ELISA-H00001388-M02-img0004.jpg "Sandwich ELISA: ATF6 beta Antibody (4D10) [H00001388-M02] - Detection limit for recombinant GST tagged CREBL1 is approximately 1ng/ml as a capture antibody.")
![N/A IL-10 [Biotin]](https://images.novusbio.com/images2/DATA_IL10_DY417_ELISA_2014.jpg)
