| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 374-470 of Human Peripherin Source: Wheat Germ (in vitro) Amino Acid Sequence: RHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLNIKTTVPEVEPPQDSHSRKTVLIKTIETRNGEVVTESQKEQRSELDKSSAHSY |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Recombinant Protein |
| Gene | PRPH |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Theoretical MW | 36.41 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for Peripherin Partial Recombinant Protein (H00005630-Q01)Find related products by research area.
|
|
Successful Transplantation of Friedreich Ataxia Induced Pluripotent Stem Cell (iPSC)-Derived Sensory Neurons in Dorsal Root Ganglia of Adult Rodents Jamshed Arslan, Pharm D, PhD The dorsal root ganglia (DRG) are a collection of cell bodies of sensory nerves carrying sensory information – including nociception, mechanoreception and proprioception – from periphera... Read full blog post. |
|
A Look at Peripherin: The Unknown Filament The exact function of Peripherin, or Neurofilament 4, is unknown however it has been suggested to play a role in axon formation and determining and maintaining the shape of nerve cells. Peripherin is a 470 amino acid Class-III neuronal intermediate fi... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PRPH |
![Immunohistochemistry Desmin Antibody [Unconjugated]](https://images.novusbio.com/images2/Desmin_AF3844_Immunohistochemistry_10689.jpg)
![Immunohistochemistry Desmin Antibody [Unconjugated]](https://images.novusbio.com/images2/Desmin_AF3844_Immunohistochemistry_6808.jpg)
![Immunocytochemistry/ Immunofluorescence Desmin Antibody [Unconjugated]](https://images.novusbio.com/images/af3844_human-mouse-desmin-affinity-purified-polyclonal-ab-41202410331920.jpg)
![SDS-PAGE beta-NGF [Unconjugated]](https://images.novusbio.com/images2/beta-NGF_256-GF_321.jpg)
![Bioactivity beta-NGF [Unconjugated]](https://images.novusbio.com/images2/beta-NGF_256-GF_322.jpg)
![Immunocytochemistry Nestin Antibody (196908) [Unconjugated]](https://images.novusbio.com/images2/Nestin_MAB1259_Immunocytochemistry_6561.jpg)
![Intracellular Staining by Flow Cytometry Nestin Antibody (196908) [Unconjugated]](https://images.novusbio.com/images/antibody/mab1259_human-nestin-mab-clone-196908-intracellular-staining-by-flow-cytometry-24120239959.jpg)
![Western Blot Nestin Antibody (196908) [Unconjugated]](https://images.novusbio.com/images/mab1259_human-nestin-mab-clone-196908-41202410481129.jpg)
![Immunocytochemistry/Immunofluorescence: Peripherin Antibody [NB300-137] - Mixed neuron/glia cultures from newborn rat brain stained with NB300-137 antibody to peripherin (green) and chicken polyclonal antibody to phosphorylated NF-H (red channel). A class of large neurons, like the one at the top right of this image, contain peripherin, while the majority of neurons and their processes contain NF-H and not peripherin. The blue channel reveals the localization of DNA.](https://images.novusbio.com/images/Peripherin-Antibody-Immunocytochemistry-Immunofluorescence-NB300-137-img0001.jpg "Immunocytochemistry/Immunofluorescence: Peripherin Antibody [NB300-137] - Mixed neuron/glia cultures from newborn rat brain stained with NB300-137 antibody to peripherin (green) and chicken polyclonal antibody to phosphorylated NF-H (red channel). A class of large neurons, like the one at the top right of this image, contain peripherin, while the majority of neurons and their processes contain NF-H and not peripherin. The blue channel reveals the localization of DNA.")