Home » PER3 » PER3 Proteins » Recombinant Human PER3 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human PER3 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

100% Guarantee on every product

Recombinant Human PER3 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1105-1201 of Human PER3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: WRMIRQTPERILMTYQVPERVKEVVLKEDLEKLESMRQQQPQFSHGQKEELAKVYNWIQSQTVTQEIDIQACVTCENEDSADGAATSCGQVLVEDSC
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PER3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PER3 GST (N-Term) Protein

  • Cell growth-inhibiting gene 13 protein
  • Circadian clock protein PERIOD 3
  • GIG13
  • growth-inhibiting protein 13
  • hPER3
  • period (Drosophila) homolog 3
  • period 3
  • period circadian protein 3
  • period circadian protein homolog 3
  • period homolog 3 (Drosophila)

Background

This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. Circadian expression in the suprachiasmatic nucleus continues in constant darkness, and a shift in the light/dark cycle evokes a proportional shift of gene expression in the suprachiasmatic nucleus. The specific function of this gene is not yet known. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PER2 Antibody -
BSA Free
NB100-125
Western Blot PER2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PER2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PER2 Antibody - BSA Free
(3 Reviews)
(9 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
PER1 Antibody
NBP2-24589
Immunohistochemistry-Paraffin PER1 Antibody
Western Blot PER1 Antibody
(1 Review)
(3 Publications)
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC, IHC-P, KO, WB
PGAP3 Antibody
NBP3-12196
Immunohistochemistry-Paraffin PGAP3 Antibody
Species: Hu, Mu, Rt
Applications: DB, ELISA, IHC, IHC-P, IP, WB
BMAL1 Antibody
NB100-2288
Flow (Intracellular) BMAL1 Antibody
Immunohistochemistry BMAL1 Antibody
Flow Cytometry BMAL1 Antibody
(1 Review)
(66 Publications)
Species: Am, Hu, Mu, Pm, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
CRY2 Antibody
(OTI1H5)
NBP2-00749
Flow Cytometry CRY2 Antibody (OTI1H5)
Flow Cytometry CRY2 Antibody (OTI1H5)
Immunohistochemistry-Paraffin CRY2 Antibody (OTI1H5)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
CRY1 Antibody
[Unconjugated]
AF3764
Immunocytochemistry CRY1 Antibody [Unconjugated]
(1 Publication)
Species: Hu, Mu
Applications: ICC, IHC, WB
CLOCK Antibody
NB100-126
Western Blot CLOCK Antibody
(3 Publications)
Species: Hu, Mu
Applications: ChIP, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
Vitamin D BP
Antibody [Unconjugate
AF4188
Simple Western Vitamin D BP Antibody [Unconjugated]
Western Blot Vitamin D BP Antibody [Unconjugated]
(1 Publication)
Species: Mu
Applications: Simple Western, WB
HSD17B4 Antibody
NBP1-85296
Immunohistochemistry-Paraffin HSD17B4 Antibody
Immunohistochemistry-Paraffin HSD17B4 Antibody
Immunohistochemistry-Paraffin HSD17B4 Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
D Box Binding
Protein Antibody
NBP2-83997
Immunohistochemistry D Box Binding Protein Antibody
Western Blot D Box Binding Protein Antibody
Western Blot D Box Binding Protein Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Timeless Antibody
NB100-40853
Western Blot Timeless Antibody
Immunohistochemistry-Paraffin Timeless Antibody
Western Blot Timeless Antibody
(1 Review)
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Exosome component
10 Antibody
NBP1-32870
Western Blot Exosome component 10 Antibody
Immunohistochemistry-Paraffin Exosome component 10 Antibody
Western Blot Exosome component 10 Antibody
(2 Reviews)
(3 Publications)
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(803 Publications)
Species: Hu
Applications: BA
Recombinant Human
PER3 GST (N-Term) Pro ...
H00008863-Q01
Recombinant Human PER3 GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for PER3 Partial Recombinant Protein (H00008863-Q01) (0)

There are no publications for PER3 Partial Recombinant Protein (H00008863-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PER3 Partial Recombinant Protein (H00008863-Q01) (0)

There are no reviews for PER3 Partial Recombinant Protein (H00008863-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PER3 Partial Recombinant Protein (H00008863-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PER3 Products

Research Areas for PER3 Partial Recombinant Protein (H00008863-Q01)

Find related products by research area.

Blogs on PER3

There are no specific blogs for PER3, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Flow (Intracellular): BMAL1 Antibody [NB100-2288] - An intracellular stain was performed on HeLa cells with NB100-2288AF647(blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
BMAL1 Antibody
NB100-2288

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PER3 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol PER3