![Western Blot: PDIR Antibody [NBP1-92252] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)](http://images.novusbio.com/fullsize/PDIR-Antibody-Western-Blot-NBP1-92252-img0006.jpg "Western Blot: PDIR Antibody [NBP1-92252] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAPWCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PDIA5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-92252 | Applications | Species |
|---|---|---|
| Chamberlain N, Ruban M, Mark Z et al. Protein Disulfide Isomerase A3 Regulates Influenza Neuraminidase Activity and Influenza Burden in the Lung International Journal of Molecular Sciences 2022-01-19 [PMID: 35162999] (WB, Mouse) | WB | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for PDIR Antibody (NBP1-92252)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PDIA5 |
![Immunocytochemistry/Immunofluorescence: PDIR Antibody [NBP1-92252] - Staining of human cell line U-251 MG shows positivity in nucleoli, nucleus but not nucleoli and golgi apparatus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/PDIR-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92252-img0004.jpg "Immunocytochemistry/Immunofluorescence: PDIR Antibody [NBP1-92252] - Staining of human cell line U-251 MG shows positivity in nucleoli, nucleus but not nucleoli and golgi apparatus. Antibody staining is shown in green.")
![Immunohistochemistry: PDIR Antibody [NBP1-92252] - Immunohistochemistry analysis in human placenta and skeletal muscle tissues using NBP1-92252 antibody. Corresponding PDIA5 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/nbp1-92252_rabbit-polyclonal-pdir-antibody-1752023133401.jpg "Immunohistochemistry: PDIR Antibody [NBP1-92252] - Immunohistochemistry analysis in human placenta and skeletal muscle tissues using NBP1-92252 antibody. Corresponding PDIA5 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry: PDIR Antibody [NBP1-92252] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic and decidual cells.](http://images.novusbio.com/fullsize/nbp1-92252_rabbit-polyclonal-pdir-antibody-175202313342032.jpg "Immunohistochemistry: PDIR Antibody [NBP1-92252] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic and decidual cells.")
![Immunohistochemistry: PDIR Antibody [NBP1-92252] - Staining of human testis shows moderate to strong granular cytoplasmic positivity Leydig cells and in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/nbp1-92252_rabbit-polyclonal-pdir-antibody-175202313342077.jpg "Immunohistochemistry: PDIR Antibody [NBP1-92252] - Staining of human testis shows moderate to strong granular cytoplasmic positivity Leydig cells and in cells in seminiferous ducts.")
![Immunohistochemistry: PDIR Antibody [NBP1-92252] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/nbp1-92252_rabbit-polyclonal-pdir-antibody-175202313342052.jpg "Immunohistochemistry: PDIR Antibody [NBP1-92252] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry: PDIR Antibody [NBP1-92252] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/nbp1-92252_rabbit-polyclonal-pdir-antibody-175202313342045.jpg "Immunohistochemistry: PDIR Antibody [NBP1-92252] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry Myocilin Antibody (297817) [Unconjugated]](https://images.novusbio.com/images/antibody/mab3446_human-myocilin-mab-clone-297817-immunohistochemistry-222023115227.jpg)
![Immunohistochemistry BMP-3b/GDF-10 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1543_human-bmp-3b-gdf-10-affinity-purified-polyclonal-ab-immunocytochemistry-133202414504.jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")