![Western Blot: PAWR / PAR4 Antibody [NBP1-87338] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/PAWR-PAR4-Antibody-Western-Blot-NBP1-87338-img0017.jpg "Western Blot: PAWR / PAR4 Antibody [NBP1-87338] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PAWR |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for PAWR / PAR4 Antibody (NBP1-87338)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: PAWR / PAR4 Antibody [NBP1-87338] - Staining of human cell line SiHa shows localization to plasma membrane & actin filaments. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/PAWR---PAR4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87338-img0008.jpg "Immunocytochemistry/Immunofluorescence: PAWR / PAR4 Antibody [NBP1-87338] - Staining of human cell line SiHa shows localization to plasma membrane & actin filaments. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: PAWR / PAR4 Antibody [NBP1-87338] - Staining of human skeletal muscle shows no positivity as expected.](http://images.novusbio.com/fullsize/PAWR---PAR4-Antibody-Immunohistochemistry-Paraffin-NBP1-87338-img0015.jpg "Immunohistochemistry-Paraffin: PAWR / PAR4 Antibody [NBP1-87338] - Staining of human skeletal muscle shows no positivity as expected.")
![Western Blot: PAWR / PAR4 Antibody [NBP1-87338] - Analysis in human cell lines Caco-2 and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.](http://images.novusbio.com/fullsize/PAWR---PAR4-Antibody-Western-Blot-NBP1-87338-img0010.jpg "Western Blot: PAWR / PAR4 Antibody [NBP1-87338] - Analysis in human cell lines Caco-2 and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.")
![Immunohistochemistry-Paraffin: PAWR / PAR4 Antibody [NBP1-87338] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells and smooth muscle cells.](http://images.novusbio.com/fullsize/PAWR---PAR4-Antibody-Immunohistochemistry-Paraffin-NBP1-87338-img0012.jpg "Immunohistochemistry-Paraffin: PAWR / PAR4 Antibody [NBP1-87338] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells and smooth muscle cells.")
![Immunohistochemistry-Paraffin: PAWR / PAR4 Antibody [NBP1-87338] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/PAWR---PAR4-Antibody-Immunohistochemistry-Paraffin-NBP1-87338-img0013.jpg "Immunohistochemistry-Paraffin: PAWR / PAR4 Antibody [NBP1-87338] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PAWR / PAR4 Antibody [NBP1-87338] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/PAWR---PAR4-Antibody-Immunohistochemistry-Paraffin-NBP1-87338-img0014.jpg "Immunohistochemistry-Paraffin: PAWR / PAR4 Antibody [NBP1-87338] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in Purkinje cells.")
![Western Blot MARK2 [p Thr595] Antibody](https://images.novusbio.com/images/nbp1-78028_rabbit-polyclonal-mark2-p-thr595-antibody-255202313135151.jpg)
![Western Blot MARK2 [p Thr595] Antibody](https://images.novusbio.com/images/MARK2-[p-Thr595]-Antibody-Western-Blot-NBP1-78028-img0001.jpg)
![Western Blot MARK2 [p Thr595] Antibody](https://images.novusbio.com/images/MARK2-[p-Thr595]-Antibody-Western-Blot-NBP1-78028-img0002.jpg)
![Flow Cytometry PAR2 Antibody (344222) [Unconjugated]](https://images.novusbio.com/images2/PAR2_MAB3949_Flow_Cytometry_8427.jpg)
![Flow Cytometry PAR2 Antibody (344222) [Unconjugated]](https://images.novusbio.com/images/antibody/mab3949_human-par2-mab-clone-344222-flow-cytometry-512024112636..jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")