![Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Analysis in human parathyroid gland and liver tissues. Corresponding Parvalbumin RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Parvalbumin-Antibody-Immunohistochemistry-Paraffin-NBP2-33529-img0010.jpg "Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Analysis in human parathyroid gland and liver tissues. Corresponding Parvalbumin RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PVALB |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-33529 | Applications | Species |
|---|---|---|
| Banasr M, Lepack A, Fee C et al. Characterization of GABAergic marker expression in the chronic unpredictable stress model of depression Chronic Stress (Thousand Oaks) 2017-02-01 [PMID: 28835932] (WB, Rat) | WB | Rat |
Secondary Antibodies |
Isotype Controls |
Research Areas for Parvalbumin Antibody (NBP2-33529)Find related products by research area.
|
|
Successful Transplantation of Friedreich Ataxia Induced Pluripotent Stem Cell (iPSC)-Derived Sensory Neurons in Dorsal Root Ganglia of Adult Rodents Jamshed Arslan, Pharm D, PhD The dorsal root ganglia (DRG) are a collection of cell bodies of sensory nerves carrying sensory information – including nociception, mechanoreception and proprioception – from periphera... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: Parvalbumin Antibody [NBP2-33529] - Analysis in human cell line RPMI-8226.](http://images.novusbio.com/fullsize/Parvalbumin-Antibody-Western-Blot-NBP2-33529-img0015.jpg "Western Blot: Parvalbumin Antibody [NBP2-33529] - Analysis in human cell line RPMI-8226.")
![Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Parvalbumin-Antibody-Immunohistochemistry-Paraffin-NBP2-33529-img0014.jpg "Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Staining of human parathyroid gland shows high expression.](http://images.novusbio.com/fullsize/Parvalbumin-Antibody-Immunohistochemistry-Paraffin-NBP2-33529-img0008.jpg "Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Staining of human parathyroid gland shows high expression.")
![Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Staining of human cerebellum shows strong positivity in Purkinje cells.](http://images.novusbio.com/fullsize/Parvalbumin-Antibody-Immunohistochemistry-Paraffin-NBP2-33529-img0011.jpg "Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Staining of human cerebellum shows strong positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Staining of human cerebral cortex shows strong positivity in a small subset of neurons.](http://images.novusbio.com/fullsize/Parvalbumin-Antibody-Immunohistochemistry-Paraffin-NBP2-33529-img0012.jpg "Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Staining of human cerebral cortex shows strong positivity in a small subset of neurons.")
![Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Staining of human kidney shows strong positivity in cells in distal tubules.](http://images.novusbio.com/fullsize/Parvalbumin-Antibody-Immunohistochemistry-Paraffin-NBP2-33529-img0013.jpg "Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Staining of human kidney shows strong positivity in cells in distal tubules.")
![Immunohistochemistry GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Immunohistochemistry_6730.jpg)
![Western Blot GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Western_Blot_19950.jpg)
![Simple Western GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Simple_Western_20168.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")