Pannexin-1 Antibody - BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 297-426 of human Pannexin-1 (NP_056183.2). VPFRQKTDVLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PANX1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50-1:200
- Western Blot 1:500-1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Pannexin-1 Antibody - BSA Free
Background
The protein encoded by the Pannexin 1 gene belongs to the innexin family. Innexin family members are the structural components ofgap junctions. This protein and pannexin 2 are abundantly expressed in central nerve system (CNS) and are coexpressedin various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination withpannexin 2 may form cell type-specific gap junctions with distinct properties. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IM, IP, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IP, WB
Publications for Pannexin-1 Antibody (NBP2-94536) (0)
There are no publications for Pannexin-1 Antibody (NBP2-94536).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Pannexin-1 Antibody (NBP2-94536) (0)
There are no reviews for Pannexin-1 Antibody (NBP2-94536).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Pannexin-1 Antibody (NBP2-94536) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Pannexin-1 Products
Research Areas for Pannexin-1 Antibody (NBP2-94536)
Find related products by research area.
|
Blogs on Pannexin-1