Home » PAK1 interacting protein 1 » PAK1 interacting protein 1 Proteins » PAK1 interacting protein 1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PAK1 interacting protein 1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PAK1 interacting protein 1 Recombinant Protein Antigen (NBP2-68615PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PAK1 interacting protein 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PAK1 interacting protein 1.

Source: E. coli

Amino Acid Sequence: GTITNEKRISSVKFLSESVLAVAGDEEVIRFFDCDSLVCLCEFKAHENRVKDMISFEIPEHHVIVSASSDGFIKMWK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PAK1IP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68615.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PAK1 interacting protein 1 Recombinant Protein Antigen

  • bA421M1.5
  • FLJ20624
  • hPIP1WD repeat-containing protein 84
  • MAK11
  • p21-activated protein kinase-interacting protein 1
  • PAK1 interacting protein 1
  • PIP1PAK/PLC-interacting protein 1
  • RP11-421M1.5
  • WDR84PAK1-interacting protein 1

Background

PIP1/WDR84 (PAK1IP1) was identified as a p21-activated protein kinase (PAK) interacting protein that functions as a negative regulator of PAK activity and PAK signaling pathways. PIP1/WDR84 (PAK1IP1) contains 5 G beta-like WD repeats. The WD repeat is defined by four or more repeating units of a conserved core of approximately 40 amino acids ending with tryptophan-aspartic acid (WD). WD repeats may serve as sites of protein-protein interaction for adaptor proteins and facilitate multiprotein complex formation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TIN2 Antibody
NBP2-55709
Western Blot TIN2 Antibody
Immunocytochemistry/ Immunofluorescence TIN2 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, WB
TRF-2 Antibody -
BSA Free
NB110-57130
Flow Cytometry TRF-2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence TRF-2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence TRF-2 Antibody - BSA Free
(2 Reviews)
(147 Publications)
Species: ChHa, Hu, Mu, Pm, Rt
Applications: ChIP, DB, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
ACD Antibody
(1D8-1B6)
H00065057-M02
Western Blot ACD Antibody (1D8-1B6)
Immunocytochemistry/ Immunofluorescence ACD Antibody (1D8-1B6)
Immunohistochemistry-Paraffin ACD Antibody (1D8-1B6)
(1 Review)
(8 Publications)
Species: Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
TIPRL Antibody
(OTI3D11)
NBP2-02269
Flow Cytometry TIPRL Antibody (OTI3D11)
Flow Cytometry TIPRL Antibody (OTI3D11)
Western Blot TIPRL Antibody (OTI3D11)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
POT1 Antibody
NB500-176
Western Blot POT1 Antibody
Western Blot POT1 Antibody
Western Blot POT1 Antibody
(1 Review)
(17 Publications)
Species: Hu
Applications: WB
TIP60 Antibody
NBP2-24613
Immunohistochemistry-Paraffin TIP60 Antibody
Western Blot TIP60 Antibody
Simple Western TIP60 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
ITFG1 Antibody
(936213) [Unconjugate
MAB89001
Flow Cytometry ITFG1 Antibody (936213) [Unconjugated]
(1 Publication)
Species: Hu
Applications: CyTOF-ready, Flow
TRF-1 Antibody
(57-6)
NB110-68281
Flow Cytometry TRF-1 Antibody (57-6)
Western Blot TRF-1 Antibody (57-6)
Western Blot TRF-1 Antibody (57-6)
(6 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, Simple Western, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
PRB1 Antibody
NBP3-10064
Western Blot PRB1 Antibody
Species: Hu
Applications: WB
PKN1 Antibody
NB100-56159
PKN1 Antibody
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
PAK1 Antibody (4D1)
H00005058-M02
Western Blot PAK1 Antibody (4D1)
Western Blot PAK1 Antibody (4D1)
Immunocytochemistry/ Immunofluorescence PAK1 Antibody (4D1)
(1 Publication)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
TBP like protein
TLP Antibody
NBP2-49671
Immunohistochemistry-Paraffin TBP like protein TLP Antibody
Immunohistochemistry-Paraffin TBP like protein TLP Antibody
Immunohistochemistry-Paraffin TBP like protein TLP Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Aquaporin-0
Antibody - BSA Free
NBP2-92773
Immunohistochemistry-Paraffin Aquaporin-0 Antibody - BSA Free
Immunohistochemistry-Paraffin Aquaporin-0 Antibody - BSA Free
Western Blot Aquaporin-0 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
CDC42 Antibody
(JJ086-04)
NBP2-67895
Flow Cytometry CDC42 Antibody (JJ086-04)
Immunohistochemistry-Paraffin CDC42 Antibody (JJ086-04)
Immunohistochemistry-Paraffin CDC42 Antibody (JJ086-04)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
TAX1BP3 Antibody
(4A10)
H00030851-M01
Simple Western TAX1BP3 Antibody (4A10)
Sandwich ELISA TAX1BP3 Antibody (4A10)
(1 Review)
(1 Publication)
Species: Hu
Applications: ELISA, S-ELISA, Simple Western, WB
SUCLG2 Antibody
NBP1-32521
Immunocytochemistry/ Immunofluorescence SUCLG2 Antibody
Western Blot SUCLG2 Antibody
Immunohistochemistry-Paraffin SUCLG2 Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Muscarinic
Acetylcholine Recepto ...
NBP1-87466
Immunohistochemistry-Paraffin Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody
Immunohistochemistry-Paraffin Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody
Immunocytochemistry/ Immunofluorescence Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
TRAILR2/TNFRSF10B
Antibody
NB100-56618
Immunohistochemistry-Paraffin TRAILR2/TNFRSF10B Antibody
Immunohistochemistry TRAILR2/TNFRSF10B Antibody
Western Blot TRAILR2/TNFRSF10B Antibody
(1 Review)
(43 Publications)
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, WB
ATP7b Antibody -
BSA Free
NB100-360
Immunocytochemistry/ Immunofluorescence ATP7b Antibody - BSA Free
Western Blot ATP7b Antibody - BSA Free
Immunohistochemistry ATP7b Antibody - BSA Free
(1 Review)
(22 Publications)
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-P, IP, WB

Publications for PAK1 interacting protein 1 Recombinant Protein Antigen (NBP2-68615PEP) (0)

There are no publications for PAK1 interacting protein 1 Recombinant Protein Antigen (NBP2-68615PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAK1 interacting protein 1 Recombinant Protein Antigen (NBP2-68615PEP) (0)

There are no reviews for PAK1 interacting protein 1 Recombinant Protein Antigen (NBP2-68615PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PAK1 interacting protein 1 Recombinant Protein Antigen (NBP2-68615PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PAK1 interacting protein 1 Products

Blogs on PAK1 interacting protein 1

There are no specific blogs for PAK1 interacting protein 1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: TRF-2 Antibody [NB110-57130] - An intracellular stain was performed on HeLa cells with TRF-2 Antibody NB110-57130AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
TRF-2 Antibody - BSA Free
NB110-57130

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PAK1 interacting protein 1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PAK1IP1