OTOA Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: RCMEEDTFIRTVELLGAVQGFSRPQLMTLKEKAIQVWDMPSYWREHHIVSLGRIALALNESELEQLDLSSIDTVASLSWQTEWTP |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
OTOA |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (88%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for OTOA Antibody
Background
The protein encoded by the OTOA gene is specifically expressed in the inner ear, and is located at the interface betweenthe apical surface of the inner ear sensory epithelia and their overlying acellular gels. It is prposed that thisprotein is involved in the attachment of the inner ear acellular gels to the apical surface of the underlyingnonsensory cells. Mutations in this gene are associated with autosomal recessive deafness type 22 (DFNB22).Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (provided byRefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
Species: Hu
Applications: PEP-ELISA, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
Species: Mu, Pm, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Ha, Hu, Mu, Po, Pm, Rt
Applications: B/N, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: Bind
Species: Hu
Applications: IHC
Publications for OTOA Antibody (NBP1-84363) (0)
There are no publications for OTOA Antibody (NBP1-84363).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for OTOA Antibody (NBP1-84363) (0)
There are no reviews for OTOA Antibody (NBP1-84363).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for OTOA Antibody (NBP1-84363) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional OTOA Products
Blogs on OTOA