![Immunohistochemistry-Paraffin: OSBPL3 Antibody [NBP1-82968] - Staining in human urinary bladder and pancreas tissues using anti-OSBPL3 antibody. Corresponding OSBPL3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/OSBPL3-Antibody-Immunohistochemistry-Paraffin-NBP1-82968-img0014.jpg "Immunohistochemistry-Paraffin: OSBPL3 Antibody [NBP1-82968] - Staining in human urinary bladder and pancreas tissues using anti-OSBPL3 antibody. Corresponding OSBPL3 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TLDFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSAFNIMSAEREKLKQLMEQDASSSPSAQVIGLKNALSSALAQNTDLKERLRRIHAESLLLDSPAVAKSGDNLAEE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | OSBPL3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry TIGAR/C12orf5 Antibody [Unconjugated]](https://images.novusbio.com/images2/TIGAR_AF7629_Immunocytochemistry__Immunofluorescence_22498.jpg)
![Immunohistochemistry TIGAR/C12orf5 Antibody [Unconjugated]](https://images.novusbio.com/images2/TIGAR_AF7629_Immunohistochemistry_22499.jpg)
![Western Blot TIGAR/C12orf5 Antibody [Unconjugated]](https://images.novusbio.com/images2/TIGAR_AF7629_Western_Blot_12475.jpg)
| Publications using NBP1-82968 | Applications | Species |
|---|---|---|
| Zhang M, Meng L, Zhang Z et al. The relationships of OSBPL3 expression with KI-67 expression and KRAS mutations in CRC: implications for diagnosis and prognosis BMC medical genomics 2022-12-14 [PMID: 36517805] (IHC, Human) | IHC | Human |
| Ek S, Andreasson U, Hober S et al. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Mol Cell Proteomics 2006-06-01 [PMID: 16524965] | ||
| Zhang M, Meng L, Zhang Z et al. The respective relations of expression of OSBPL3 with Ki-67 expression and KRAS mutation in CRC for diagnosis and prognosis Research Square 2022-03-28 (IF/IHC) | IF/IHC |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
IF | Human | 11/01/2017 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | OSBPL3 |
![Western Blot: OSBPL3 Antibody [NBP1-82968] - Analysis in human cell lines A-431 and MCF-7 using Anti-OSBPL3 antibody. Corresponding OSBPL3 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/OSBPL3-Antibody-Western-Blot-NBP1-82968-img0011.jpg "Western Blot: OSBPL3 Antibody [NBP1-82968] - Analysis in human cell lines A-431 and MCF-7 using Anti-OSBPL3 antibody. Corresponding OSBPL3 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.")
![Immunocytochemistry/Immunofluorescence: OSBPL3 Antibody [NBP1-82968] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli & cytosol.](http://images.novusbio.com/fullsize/OSBPL3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82968-img0008.jpg "Immunocytochemistry/Immunofluorescence: OSBPL3 Antibody [NBP1-82968] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli & cytosol.")
![Immunohistochemistry-Paraffin: OSBPL3 Antibody [NBP1-82968] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/OSBPL3-Antibody-Immunohistochemistry-Paraffin-NBP1-82968-img0012.jpg "Immunohistochemistry-Paraffin: OSBPL3 Antibody [NBP1-82968] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: OSBPL3 Antibody [NBP1-82968] - Staining of human urinary bladder shows high expression.](http://images.novusbio.com/fullsize/OSBPL3-Antibody-Immunohistochemistry-Paraffin-NBP1-82968-img0013.jpg "Immunohistochemistry-Paraffin: OSBPL3 Antibody [NBP1-82968] - Staining of human urinary bladder shows high expression.")
![Immunohistochemistry CD34 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD34_AF4117_Immunohistochemistry_6824.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Immunocytochemistry CYP7A1 Antibody (946902) [Unconjugated]](https://images.novusbio.com/images2/CYP7A1_MAB9120_Immunocytochemistry__Immunofluorescence_19938.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
