![Sandwich ELISA: OPA3 Antibody (1B8) [H00080207-M03] - Detection limit for recombinant GST tagged OPA3 is 0.1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/OPA3-Antibody-1B8-Sandwich-ELISA-H00080207-M03-img0001.jpg "Sandwich ELISA: OPA3 Antibody (1B8) [H00080207-M03] - Detection limit for recombinant GST tagged OPA3 is 0.1 ng/ml as a capture antibody.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 1B8 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | OPA3 (NP_079412.1, 103 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RHQAQQRHKEEEQRAAWNALRDEVGHLALALEALQTQVQAAPPQGALEELRTELQEVRAQLCNPGRSASHAVPASKK |
| Specificity | Reacts with optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia). |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | OPA3 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is reactive against recombinant protein in western blot and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for OPA3 Antibody (H00080207-M03)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry_6480.jpg)
![Immunohistochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunohistochemistry_22376.jpg)
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry__Immunofluorescence_22492.jpg)
![Immunohistochemistry Myocilin Antibody (297817) [Unconjugated]](https://images.novusbio.com/images/antibody/mab3446_human-myocilin-mab-clone-297817-immunohistochemistry-222023115227.jpg)
![Western Blot Myocilin Antibody (297817) [Unconjugated]](https://images.novusbio.com/images/mab3446_human-myocilin-mab-clone-297817-8120255531646.jpg)
![Western Blot Myocilin Antibody (297817) [Unconjugated]](https://images.novusbio.com/images/mab3446_human-myocilin-mab-clone-297817-812025557214.jpg)
![Immunocytochemistry S100A8 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A8_AF3059_Immunocytochemistry_6489.jpg)
![Western Blot S100A8 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A8_AF3059_Immunocytochemistry__Immunofluorescence_17308.jpg)
![Simple Western S100A8 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A8_AF3059_Simple_Western_18694.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")