Home » Olfactomedin-1/Noelin-1 » Olfactomedin-1 Peptides and Proteins » Olfactomedin-1/Noelin-1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Olfactomedin-1/Noelin-1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Olfactomedin-1/Noelin-1 Protein (NBP2-33836PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Olfactomedin-1/Noelin-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human OLFM1.

Source: E. coli

Amino Acid Sequence: IEVLDRRTQRDLQYVEKMENQMKGLESKFKQVEESHKQHLARQFKAIKAKMDE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
OLFM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33836.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Olfactomedin-1/Noelin-1 Recombinant Protein Antigen

  • AMY
  • AMYolfactomedin related ER localized protein
  • neuroblastoma protein
  • Neuronal olfactomedin-related ER localized protein
  • NOE1
  • NOE1noelin
  • NOEL1
  • NOELIN
  • NOELIN1
  • Noelin-1
  • OlfA
  • olfactomedin 1
  • Olfactomedin1
  • Olfactomedin-1
  • OLFM1
  • pancortin 1

Background

Noelin product shares extensive sequence similarity with the rat neuronal olfactomedin-related ER localized protein. While the exact function of the encoded protein is not known, its abundant expression in brain suggests that it may have an essential role in nerve tissue. Several alternatively spliced transcripts encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Pancreatic Amylase
Alpha Antibody (OTI6D ...
NBP1-47659
Immunohistochemistry-Paraffin Pancreatic Amylase Alpha Antibody (OTI6D4)
Immunohistochemistry-Paraffin Pancreatic Amylase Alpha Antibody (OTI6D4)
Immunohistochemistry-Paraffin Pancreatic Amylase Alpha Antibody (OTI6D4)
(1 Review)
Species: Hu
Applications: IHC, IHC-P, WB
Amylin Antibody
NBP2-33680
Immunohistochemistry Amylin Antibody
Immunohistochemistry-Paraffin Amylin Antibody
Immunohistochemistry-Paraffin Amylin Antibody
Species: Hu
Applications: IHC, IHC-P
Salivary Amylase
Beta Antibody
H00000277-B01P
Western Blot Salivary Amylase Beta Antibody
Western Blot Salivary Amylase Beta Antibody
Species: Hu
Applications: WB
Salivary Amylase
Alpha Antibody (5G6F7 ...
NBP2-61862
ELISA Salivary Amylase Alpha Antibody (5G6F7) - BSA Free
ELISA Salivary Amylase Alpha Antibody (5G6F7) - BSA Free
Western Blot Salivary Amylase Alpha Antibody (5G6F7) - BSA Free
Species: Hu, Rt
Applications: ELISA, Flow, WB
MYCBP Antibody
(2E9)
H00026292-M02
Immunocytochemistry/ Immunofluorescence MYCBP Antibody (2E9)
ELISA MYCBP Antibody (2E9)
Immunohistochemistry-Paraffin MYCBP Antibody (2E9)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Procalcitonin
Antibody (44D9)
NB120-14817
Procalcitonin Antibody (44D9)
(1 Review)
(11 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
RAMP1 Antibody
[Unconjugated]
AF6428
Immunohistochemistry RAMP1 Antibody [Unconjugated]
Western Blot RAMP1 Antibody [Unconjugated]
Immunohistochemistry RAMP1 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC, WB
Sialin/SLC17A5
Antibody
NBP2-20383
Immunohistochemistry-Paraffin Sialin/SLC17A5 Antibody
Western Blot Sialin/SLC17A5 Antibody
Immunocytochemistry/ Immunofluorescence Sialin/SLC17A5 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
EN-RAGE/S100A12
Antibody [Unconjugate
AF1052
Immunohistochemistry EN-RAGE/S100A12 Antibody [Unconjugated]
Western Blot EN-RAGE/S100A12 Antibody [Unconjugated]
Simple Western EN-RAGE/S100A12 Antibody [Unconjugated]
(3 Reviews)
(7 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Pancreatic Amylase
Beta Antibody (OTI4B5 ...
NBP2-45492
Immunohistochemistry Pancreatic Amylase Beta Antibody (OTI4B5)
Immunohistochemistry Pancreatic Amylase Beta Antibody (OTI4B5)
Western Blot Pancreatic Amylase Beta Antibody (OTI4B5)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
RPL29 Antibody
NBP3-12600
Western Blot RPL29 Antibody
Immunohistochemistry-Paraffin RPL29 Antibody
Immunohistochemistry-Paraffin RPL29 Antibody
Species: Hu
Applications: ICC/IF, IHC-P, IP, WB
Reg3A Antibody
NBP2-24763
Western Blot Reg3A Antibody
Immunohistochemistry-Paraffin Reg3A Antibody
(3 Publications)
Species: Hu, Pm
Applications: IHC, IHC-P, WB
Hsp70 interacting
protein HIP Antibody
NBP2-47427
Immunocytochemistry/ Immunofluorescence Hsp70 interacting protein HIP Antibody
Immunohistochemistry-Paraffin Hsp70 interacting protein HIP Antibody
Western Blot Hsp70 interacting protein HIP Antibody
(1 Publication)
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P, WB
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Hip Antibody
[Unconjugated]
AF1568
Hip Antibody [Unconjugated]
(6 Publications)
Species: Mu
Applications: WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Neurophysin
II/Arg-vasopressin An ...
AF009
Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]
Species: Hu
Applications: IHC, WB
Adrenomedullin/ADM
Antibody [Unconjugate ...
AF6108
Immunohistochemistry Adrenomedullin/ADM Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA

Publications for Olfactomedin-1/Noelin-1 Protein (NBP2-33836PEP) (0)

There are no publications for Olfactomedin-1/Noelin-1 Protein (NBP2-33836PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Olfactomedin-1/Noelin-1 Protein (NBP2-33836PEP) (0)

There are no reviews for Olfactomedin-1/Noelin-1 Protein (NBP2-33836PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Olfactomedin-1/Noelin-1 Protein (NBP2-33836PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Olfactomedin-1/Noelin-1 Products

Research Areas for Olfactomedin-1/Noelin-1 Protein (NBP2-33836PEP)

Find related products by research area.

Blogs on Olfactomedin-1/Noelin-1

There are no specific blogs for Olfactomedin-1/Noelin-1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Albumin Antibody (188835) [Unconjugated] - Serum
MAB1455

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Olfactomedin-1/Noelin-1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol OLFM1