Reactivity | HuSpecies Glossary |
Applications | WB, ELISA, MA, AP |
Description | Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 164 of Human POU5F1 full-length ORF Source: Wheat Germ (in vitro) Amino Acid Sequence: MCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN |
Preparation Method |
in vitro wheat germ expression system |
Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
Source | Wheat germ |
Protein/Peptide Type | Full Length Recombinant Protein |
Gene | POU5F1 |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Dilutions |
|
Theoretical MW | 44.7 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at -80C. Avoid freeze-thaw cycles. |
Buffer | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Preservative | No Preservative |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for OCT4 Recombinant Protein (H00005460-P01)Find related products by research area.
|
Breast cancer stem cells survive chemotherapy through S100A10-ANXA2-SPT6 interaction that epigenetically promotes OCT4-mediated stemness By Jamshed Arslan, Pharm D, PhDBreast cancer is the most common cancer among women that causes the greatest number of cancer-related deaths worldwide. After radiotherapy or cytotoxic chemotherapy like paclitax... Read full blog post. |
Deriving neural precursor cells from human induced pluripotent stem cells By Jennifer Sokolowski, MD, PhD.Human induced pluripotent stem cells (iPSCs) can be used to create models of human organ systems and are useful for a) ascertaining the mechanisms underlying pathological conditions... Read full blog post. |
Application Focus: New Methods for iPSC Differentiation, Inducing a Mammary Fate Discovery of the Key to PluripotencyInduced pluripotent stem cells (iPSCs) may be generated from a wide range of fully differentiated cells, and under optimal conditions may be prompted to differentiate into virtu... Read full blog post. |
Stemness for Surviving Hypoxia: TGF-beta/Smad Signaling in Multiple Myeloma By Jamshed Arslan Pharm.D. Multiple myeloma (MM) is a cancer of antibody-producing plasma cells. The bone marrow (BM) of MM patients is hypoxic, and MM cells overexpress many cancerous genes that are regulated by hy... Read full blog post. |
Nanog is a Master Controller of ES cell Pluripotency Nanog, a homeodomain (HD) transcription factor, plays a critical role in the maintenance of embryonic stem (ES) cell self-renewal. Transcription regulator involved in inner cell mass and ES cell proliferation and self-renewal. Imposes pluripotency on ... Read full blog post. |
Histones, Bmi1 & OCT4: Investigating the Secrets of ESC Pluripotency Epigenetic alterations have come to prominence in biomedical research. In particular, hypermethylation of CpG islands located in the promoter regions of tumor-suppressor genes is now firmly established as an important mechanism for gene inactivation i... Read full blog post. |
Sox2 and Oct4: Roles in Embryonic Stem Cell Pluripotency Embryonic stem (ES) cells are cells derived from the inner cell mass of the blastocyst, an early-stage embryo. ES cells are distinguished from other cells due to their pluripotency, which is the ability to differentiate into any different type of cell... Read full blog post. |
An Unlikely Pairing: The SOX2 Antibody and Breast Cancer SOX2 encodes a member of the SOX (SRY-related HMG-box) family of transcription factors, which play a vital role in embryonic development. SOX2 antibody research has identified Sox2 as a key transcription factor in pluripotent stem cells. We at Novus B... Read full blog post. |
The Sox2 Antibody Aids Brain Cancer Research The Sox2 antibody is widely used in sensory, neuroscience and stem cell marker research. Recently, Sox2 antibody preparations identified the Sox2 protein as a marker for malignant neural gliomas. We at Novus Biologicals offer a wide variety of highly ... Read full blog post. |
Not as Pluripotent as You Used to Be: Embryonic Stem Cell Markers and the Aging Process We at Novus Biologicals recently extended our antibody catalog to include several embryonic stem cells (ESC) antibodies validated for use in FACS (fluorescent activated cell sorting) assays. Among them was Oct4, which recently became the focus of an i... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | POU5F1 |