![Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining in human liver and kidney tissues using NBP1-80980 antibody. Corresponding SLCO1B3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/OATP1B3-SLCO1B3-OATP8-Antibody-Immunohistochemistry-Paraffin-NBP1-80980-img0014.jpg "Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining in human liver and kidney tissues using NBP1-80980 antibody. Corresponding SLCO1B3 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLCO1B3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for OATP1B3/SLCO1B3/OATP8 Antibody (NBP1-80980)Find related products by research area.
|
|
OATP8 - A membrane transport protein responsible for cancer drug uptake Human hepatocytes express important transport proteins that are responsible for the uptake and removal of organic anions from the blood. These proteins are members of the organic anion-transporting polypeptide (OATP) family and are essential for pr... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human cell line A-431 shows positivity in cytoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/OATP1B3-SLCO1B3-OATP8-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80980-img0004.jpg "Immunocytochemistry/Immunofluorescence: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human cell line A-431 shows positivity in cytoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human cerebral cortex shows no positivity in neurons as expected.](http://images.novusbio.com/fullsize/OATP1B3-SLCO1B3-OATP8-Antibody-Immunohistochemistry-Paraffin-NBP1-80980-img0010.jpg "Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human cerebral cortex shows no positivity in neurons as expected.")
![Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human kidney shows no positivity in cells in tubules as expected.](http://images.novusbio.com/fullsize/OATP1B3-SLCO1B3-OATP8-Antibody-Immunohistochemistry-Paraffin-NBP1-80980-img0011.jpg "Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human kidney shows no positivity in cells in tubules as expected.")
![Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human liver shows strong membranous positivity in hepatocytes.](http://images.novusbio.com/fullsize/OATP1B3-SLCO1B3-OATP8-Antibody-Immunohistochemistry-Paraffin-NBP1-80980-img0012.jpg "Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human liver shows strong membranous positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human skin shows no positivity in squamous epithelial cells as expected.](http://images.novusbio.com/fullsize/OATP1B3-SLCO1B3-OATP8-Antibody-Immunohistochemistry-Paraffin-NBP1-80980-img0013.jpg "Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human skin shows no positivity in squamous epithelial cells as expected.")
![PXR/NR1I2 Antibody (H4417) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "PXR/NR1I2 Antibody (H4417) [Unconjugated]")
![Bioactivity IBSP/Sialoprotein II [Unconjugated]](https://images.novusbio.com/images/4014-sp_recombinant-human-ibsp-sialoprotein-ii-protein-cf-bioactivity-4420249391..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")