![Immunohistochemistry-Paraffin: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566] - Analysis in human placenta and skeletal muscle tissues. Corresponding MYH10 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/non-muscle-heavy-chain-10-Myosin-Antibody-Immunohistochemistry-Paraffin-NBP2-38566-img0019.jpg "Immunohistochemistry-Paraffin: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566] - Analysis in human placenta and skeletal muscle tissues. Corresponding MYH10 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RQLDDATEANEGLSREVSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLELSDDDTESKTSDVNETQPPQ |
| Predicted Species | Mouse (96%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MYH10 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566] - Analysis in human cell lines HEK293 and PC-3 using anti-MYH10 antibody. Corresponding MYH10 RNA-seq data are presented for the same cell lines. Loading control: anti-PFN1.](http://images.novusbio.com/fullsize/non-muscle-heavy-chain-10-Myosin-Antibody-Western-Blot-NBP2-38566-img0015.jpg "Western Blot: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566] - Analysis in human cell lines HEK293 and PC-3 using anti-MYH10 antibody. Corresponding MYH10 RNA-seq data are presented for the same cell lines. Loading control: anti-PFN1.")
![Immunohistochemistry-Paraffin: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/non-muscle-heavy-chain-10-Myosin-Antibody-Immunohistochemistry-Paraffin-NBP2-38566-img0021.jpg "Immunohistochemistry-Paraffin: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/non-muscle-heavy-chain-10-Myosin-Antibody-Immunohistochemistry-Paraffin-NBP2-38566-img0016.jpg "Immunohistochemistry-Paraffin: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566] - Staining of human cerebellum shows weak to moderate cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/non-muscle-heavy-chain-10-Myosin-Antibody-Immunohistochemistry-Paraffin-NBP2-38566-img0018.jpg "Immunohistochemistry-Paraffin: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566] - Staining of human cerebellum shows weak to moderate cytoplasmic positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566] - Staining of human kidney shows moderate membranous positivity in cells in tubules.](http://images.novusbio.com/fullsize/non-muscle-heavy-chain-10-Myosin-Antibody-Immunohistochemistry-Paraffin-NBP2-38566-img0020.jpg "Immunohistochemistry-Paraffin: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566] - Staining of human kidney shows moderate membranous positivity in cells in tubules.")
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22971.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22972.jpg)
![Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunocytochemistry_9890.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")