![Immunocytochemistry/Immunofluorescence: NHLH2 Antibody (1F4) [H00004808-M04] - Analysis of monoclonal antibody to NHLH2 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize/NHLH2-Antibody-1F4-Immunocytochemistry-Immunofluorescence-H00004808-M04-img0002.jpg "Immunocytochemistry/Immunofluorescence: NHLH2 Antibody (1F4) [H00004808-M04] - Analysis of monoclonal antibody to NHLH2 on HeLa cell. Antibody concentration 10 ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 1F4 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | NHLH2 (NP_005590, 36 a.a. ~ 135 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATR ERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV |
| Specificity | NHLH2 (1F4) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | NHLH2 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for NHLH2 Antibody (H00004808-M04)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![ELISA: NHLH2 Antibody (1F4) [H00004808-M04] - Detection limit for recombinant GST tagged NHLH2 is approximately 1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/NHLH2-Antibody-1F4-ELISA-H00004808-M04-img0001.jpg "ELISA: NHLH2 Antibody (1F4) [H00004808-M04] - Detection limit for recombinant GST tagged NHLH2 is approximately 1ng/ml as a capture antibody.")
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/Leptin_DLP00_ELISA_134.jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/DATA_Leptin_DLP00_ELISA_749.jpg)
![Immunocytochemistry NeuroD1 Antibody [Unconjugated]](https://images.novusbio.com/images2/NeuroD1_AF2746_Immunocytochemistry_7291.jpg)
![Immunohistochemistry ASCL1/Mash1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2567_mouse-ascl1-mash1-affinity-purified-polyclonal-ab-immunohistochemistry-1732021122114.jpg)
![Immunocytochemistry LMO2 Antibody [Unconjugated]](https://images.novusbio.com/images2/LMO2_AF2726_Immunocytochemistry_10616.jpg)
![Flow Cytometry LMO2 Antibody [Unconjugated]](https://images.novusbio.com/images2/LMO2_AF2726_Flow_Cytometry_22133.jpg)
![Flow Cytometry LMO2 Antibody [Unconjugated]](https://images.novusbio.com/images2/LMO2_AF2726_Flow_Cytometry_22134.jpg)
