Home » NHLH1 » NHLH1 Proteins » NHLH1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

NHLH1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for NHLH1 Protein (NBP2-13655PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

NHLH1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NHLH1.

Source: E. coli

Amino Acid Sequence: MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQHLSREE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NHLH1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13655.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NHLH1 Recombinant Protein Antigen

  • BHLHA35
  • bHLHa35HEN-1
  • helix-loop-helix protein 1
  • HEN1NSCL-1
  • nescient helix loop helix 1Class A basic helix-loop-helix protein 35
  • NSCL
  • NSCL1

Background

The helix-loop-helix (HLH) proteins are a family of putative transcription factors, some of which have been shown to play an important role in growth and development of a wide variety of tissues and species. Four members of this family have been clearly implicated in tumorigenesis via their involvement in chromosomal translocations in lymphoid tumors: MYC (MIM 190080), LYL1 (MIM 151440), E2A (MIM 147141), and SCL (MIM 187040).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NHLH2 Antibody
NBP2-30642
Immunohistochemistry-Paraffin NHLH2 Antibody
Immunocytochemistry/ Immunofluorescence NHLH2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
IRF6 Antibody
NBP1-51911
Western Blot IRF6 Antibody
Western Blot IRF6 Antibody
Immunohistochemistry-Paraffin IRF6 Antibody
(8 Publications)
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, PEP-ELISA, WB
CD302/CLEC13A
Antibody
AF6367
Western Blot CD302/CLEC13A Antibody
Flow Cytometry CD302/CLEC13A Antibody
Species: Hu
Applications: CyTOF-ready, Flow, WB
PIWIL1/HIWI
Antibody
AF6548
Immunohistochemistry PIWIL1/HIWI Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC
SCL/Tal1 Antibody
(OTI5H1)
NBP2-01488
Western Blot SCL/Tal1 Antibody (OTI5H1)
Flow Cytometry SCL/Tal1 Antibody (OTI5H1)
Immunocytochemistry/ Immunofluorescence SCL/Tal1 Antibody (OTI5H1)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NeuroD1 Antibody
[Unconjugated]
AF2746
Immunocytochemistry NeuroD1 Antibody [Unconjugated]
(18 Publications)
Species: Hu, Mu
Applications: ICC, WB
EPHX1 Antibody
NBP1-83969
Immunohistochemistry-Paraffin EPHX1 Antibody
Immunohistochemistry-Paraffin EPHX1 Antibody
Immunohistochemistry-Paraffin EPHX1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
PIWIL4 Antibody
(10G9B11) - BSA Free
NBP2-37398
ELISA PIWIL4 Antibody (10G9B11) - BSA Free
Western Blot PIWIL4 Antibody (10G9B11) - BSA Free
Western Blot PIWIL4 Antibody (10G9B11) - BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
MTHFR Antibody
(5D3) - BSA Free
NBP2-37607
Immunohistochemistry-Paraffin MTHFR Antibody (5D3) - BSA Free
ELISA MTHFR Antibody (5D3) - BSA Free
Western Blot MTHFR Antibody (5D3) - BSA Free
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Dicer Antibody -
BSA Free
NBP1-71691
Immunocytochemistry/ Immunofluorescence Dicer Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Dicer Antibody - BSA Free
Immunohistochemistry Dicer Antibody - BSA Free
(1 Review)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
TCF-3/E2A Antibody
(826927) [Unconjugate ...
MAB7650
Western Blot TCF-3/E2A Antibody (826927) [Unconjugated]
Immunohistochemistry TCF-3/E2A Antibody (826927) [Unconjugated]
(2 Publications)
Species: Mu
Applications: IHC, WB
KAT4/TBP
Associated Factor 1 A
NBP1-77847
Immunohistochemistry KAT4/TBP Associated Factor 1 Antibody
Immunohistochemistry KAT4/TBP Associated Factor 1 Antibody
Western Blot KAT4/TBP Associated Factor 1 Antibody
Species: Hu, Mu
Applications: ChIP, ELISA, IHC, IHC-P, IP, WB
ELSPBP1 Antibody
NBP2-13957
Western Blot ELSPBP1 Antibody
Immunohistochemistry-Paraffin ELSPBP1 Antibody
Immunohistochemistry-Paraffin ELSPBP1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
PNK Antibody
NBP1-87257
Immunocytochemistry/ Immunofluorescence PNK Antibody
Western Blot PNK Antibody
Western Blot PNK Antibody
(9 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, KO, Simple Western, WB
CSRP3 Antibody
NBP1-06983
Western Blot CSRP3 Antibody
Immunohistochemistry-Paraffin CSRP3 Antibody
Immunohistochemistry-Paraffin CSRP3 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PEP-ELISA, WB
TEAD1 Antibody -
Azide and BSA Free
NBP2-94035
Chromatin Immunoprecipitation TEAD1 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence TEAD1 Antibody - Azide and BSA Free
Western Blot TEAD1 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
NHLH1 Recombinant
Protein Antigen
NBP2-13655PEP
NHLH1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for NHLH1 Protein (NBP2-13655PEP) (0)

There are no publications for NHLH1 Protein (NBP2-13655PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NHLH1 Protein (NBP2-13655PEP) (0)

There are no reviews for NHLH1 Protein (NBP2-13655PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NHLH1 Protein (NBP2-13655PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NHLH1 Products

Research Areas for NHLH1 Protein (NBP2-13655PEP)

Find related products by research area.

Blogs on NHLH1

There are no specific blogs for NHLH1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NHLH1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NHLH1