Novus Biologicals products are now on bio-techne.com

NFkB p100/p52 Recombinant Protein Antigen

Images

 
There are currently no images for NFkB p100/p52 Protein (NBP1-87759PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

NFkB p100/p52 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NFKB2.

Source: E. coli

Amino Acid Sequence: ICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NFKB2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87759.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NFkB p100/p52 Recombinant Protein Antigen

  • DNA-binding factor KBF2
  • H2TF1
  • Lymphocyte translocation chromosome 10 protein
  • Lyt10
  • LYT10LYT-10
  • nuclear factor NF-kappa-B p100 subunit
  • nuclear factor of kappa light chain gene enhancer in B-cells 2
  • nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100)
  • Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2
  • Oncogene Lyt-10
  • p52

Background

The NFkappaB transcription factor was originally identified as a protein complex consisting of a DNA binding subunit and an associated protein. The DNA binding subunit is functionally related to c-Rel p75 and Rel B p68. The p50 subunit was initially believed to be a functionally unique protein derived from the amino-terminus of a precursor designated p105. A cDNA has been isolated that encodes an alternative DNA binding subunit of NFkappaB. It is synthesized as a protein that is expressed in a variety of cell types and, like p105, undergoes cleavage to generate its NFkappaB subunit, in this case a protein designated p52 (previously referred to as p49). In contrast to p50 derived from p105, p52 acts in synergy with p65 to stimulate the HIV enhancer in transiently transfected Jurkat cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA
AF632
Species: Hu
Applications: AgAct, Simple Western, WB
NBP1-88650
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP2-01345
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF2699
Species: Mu
Applications: Simple Western, WB
MAB4364
Species: Rt
Applications: ICC, IHC, IP, KO, WB
AF2849
Species: Mu, Rt
Applications: WB
NBP2-02665
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NB100-74648
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
NBP2-94469
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
NBP1-85841
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB500-179
Species: Hu, Ma, Mu, Po, Rt
Applications: Flow, ICC/IF, IP, KD, Simple Western, WB
NBP2-72273
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, WB
NBP2-20123
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
NB100-56507
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
NBP2-02434
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for NFkB p100/p52 Protein (NBP1-87759PEP) (0)

There are no publications for NFkB p100/p52 Protein (NBP1-87759PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NFkB p100/p52 Protein (NBP1-87759PEP) (0)

There are no reviews for NFkB p100/p52 Protein (NBP1-87759PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NFkB p100/p52 Protein (NBP1-87759PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NFkB p100/p52 Products

Research Areas for NFkB p100/p52 Protein (NBP1-87759PEP)

Find related products by research area.

Blogs on NFkB p100/p52.

Nuclear Factor kappa B Signaling in the Immune System
Nuclear Factor kappa B (NFkB) binds to the kappa-beta site of the immunoglobulin kappa light chain gene enhancer. Thus NFkB has become one of the widely studied transcription factors in innate and adaptive immune responses. The NFkB family is composed...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NFkB p100/p52 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NFKB2