Home » Nestin » Nestin Proteins » Nestin Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Nestin Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Nestin Recombinant Protein Antigen (NBP2-48575PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Nestin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Nestin

Source: E. coli

Amino Acid Sequence: EPLRSLEDENKEAFRSLEKENQEPLKTLEEEDQSIVRPLETENHKSLRSLEEQDQETLRTLEKETQQRRRSLGEQDQMTLRPPEKVDLEPLKSLDQEIARPLENENQEFLKSLKEESVEAVKSLETEILESLKSAGQENLETLK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NES
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48575.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Nestin Recombinant Protein Antigen

  • FLJ21841
  • NES
  • Nestin

Background

Nestin is a Class VI intermediate filament expressed in the developing central nervous system in early embryonic neuroepithelial stem cells. This protein has been widely used as a predominant marker for stem / progenitor cells, glioma cells, and tumor endothelial cells. Furthermore, it is a superior angiogenic marker to evaluate neovascularity of endothelial cells in tumor. Because if it's roles in angiogenisis and tumorgenesis, Nestin antibodies are useful cancer markers.

Although it is often used as a marker for proliferating and migrating cells very little is known about Nestin's function or regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

GFAP Antibody
NB300-141
Immunohistochemistry GFAP Antibody
Western Blot GFAP Antibody
Western Blot GFAP Antibody
(12 Reviews)
(108 Publications)
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Vimentin Antibody
NB300-223
Immunocytochemistry/ Immunofluorescence Vimentin Antibody
Immunohistochemistry-Frozen Vimentin Antibody
Immunocytochemistry/ Immunofluorescence Vimentin Antibody
(6 Reviews)
(70 Publications)
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
FGF
basic/FGF2/bFGF [Unco
233-FB
FGF basic/FGF2/bFGF [Unconjugated]
(545 Publications)
Species: Hu
Applications: BA
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(829 Publications)
Species: Hu
Applications: BA
Desmin Antibody
[Unconjugated]
AF3844
Immunohistochemistry Desmin Antibody [Unconjugated]
Immunohistochemistry Desmin Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence Desmin Antibody [Unconjugated]
(2 Reviews)
(34 Publications)
Species: Hu, Mu
Applications: IHC
MAP2 Antibody
NB300-213
Western Blot MAP2 Antibody
Immunocytochemistry/ Immunofluorescence MAP2 Antibody
Immunocytochemistry/ Immunofluorescence MAP2 Antibody
(5 Reviews)
(115 Publications)
Species: Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
Oct-3/4 Antibody
[Unconjugated]
AF1759
Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]
Immunocytochemistry Oct-3/4 Antibody [Unconjugated]
Simple Western Oct-3/4 Antibody [Unconjugated]
(75 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
CD133 Antibody -
BSA Free
NB120-16518
Immunohistochemistry-Paraffin CD133 Antibody - BSA Free
Western Blot CD133 Antibody - BSA Free
Chromatin Immunoprecipitation CD133 Antibody - BSA Free
(42 Publications)
Species: Hu, Mu, Po, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
SOX2 Antibody
[Unconjugated]
AF2018
Western Blot SOX2 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) SOX2 Antibody [Unconjugated]
Simple Western SOX2 Antibody [Unconjugated]
(6 Reviews)
(365 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
CRM1 Antibody
NB100-79802
Immunohistochemistry-Paraffin CRM1 Antibody
Immunohistochemistry-Paraffin CRM1 Antibody
Immunocytochemistry/ Immunofluorescence CRM1 Antibody
(16 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Enolase
2/Neuron-specific Eno ...
NB110-58870
Immunocytochemistry/ Immunofluorescence Enolase 2/Neuron-specific Enolase Antibody
Western Blot Enolase 2/Neuron-specific Enolase Antibody
Simple Western Enolase 2/Neuron-specific Enolase Antibody
(2 Reviews)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KD, Simple Western, WB
BDNF [HRP]
DBD00
N/A BDNF [HRP]
N/A BDNF [HRP]
N/A BDNF [HRP]
(104 Publications)
Species: Hu
Applications: ELISA
CD34 Antibody
[Unconjugated]
AF4117
Immunohistochemistry CD34 Antibody [Unconjugated]
(3 Reviews)
(37 Publications)
Species: Rt
Applications: IHC, WB
Methionine
Aminopeptidase 2/META ...
NBP3-05513
Immunocytochemistry/ Immunofluorescence Methionine Aminopeptidase 2/METAP2 Antibody
Immunohistochemistry-Paraffin Methionine Aminopeptidase 2/METAP2 Antibody
Western Blot Methionine Aminopeptidase 2/METAP2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Doublecortin
Antibody
NBP1-72042
Western Blot Doublecortin Antibody
Immunocytochemistry/ Immunofluorescence Doublecortin Antibody
Immunocytochemistry/ Immunofluorescence Doublecortin Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB

Publications for Nestin Recombinant Protein Antigen (NBP2-48575PEP) (0)

There are no publications for Nestin Recombinant Protein Antigen (NBP2-48575PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nestin Recombinant Protein Antigen (NBP2-48575PEP) (0)

There are no reviews for Nestin Recombinant Protein Antigen (NBP2-48575PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Nestin Recombinant Protein Antigen (NBP2-48575PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nestin Products

Research Areas for Nestin Recombinant Protein Antigen (NBP2-48575PEP)

Find related products by research area.

Blogs on Nestin.

Check out the latest blog posts on Nestin.
Deriving neural precursor cells from human induced pluripotent stem cells
By Jennifer Sokolowski, MD, PhD.Human induced pluripotent stem cells (iPSCs) can be used to create models of human organ systems and are useful for a) ascertaining the mechanisms underlying pathological conditions...  Read full blog post.
Nestin: Investigating the Link Between New Brain Cells and Depression
Clinical depression (also known as major depressive disorder or MDD) affects many people, but the biological processes that cause it (and are influenced by its treatments) are not well understood. Adult neurogenesis is a newly emerging field that coul...  Read full blog post.
Nestin Antibody Products in Neuronal Cancer Research
Nestin is a large class Vl intermediate filament protein predominantly expressed in the neuroepithelial stem cells of the embryonic central nervous system, although recent nestin antibody studies have shown it expressed in other cell types, including ...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Nestin Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NES