![Immunocytochemistry/Immunofluorescence: NCKAP1 Antibody [NBP1-83269] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody shown in green.](http://images.novusbio.com/fullsize/NCKAP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83269-img0006.jpg "Immunocytochemistry/Immunofluorescence: NCKAP1 Antibody [NBP1-83269] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LSFRSLAQEALRDVLSYHIPFLVSSIEDFKDHIPRETDMKVAMNVYELSSAAGLPCEIDPALVVALSSQKSENISPEEEY |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NCKAP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Neutralization CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Block_Neutralize_9064.jpg)
![Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Immunocytochemistry_9339.jpg)
![Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/mab208_human-il-8-cxcl8-mab-clone-6217-western-blot-1882021143847.jpg)
| Publication using NBP1-83269 | Applications | Species |
|---|---|---|
| Anazi S, Maddirevula S, Salpietro V et al. Expanding the genetic heterogeneity of intellectual disability. Hum. Genet. 2017-09-22 [PMID: 28940097] (IF/IHC, Human) | IF/IHC | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for NCKAP1 Antibody (NBP1-83269)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NCKAP1 |
![Immunohistochemistry-Paraffin: NCKAP1 Antibody [NBP1-83269] - Staining in human cerebral cortex and skeletal muscle tissues using anti-NCKAP1 antibody. Corresponding NCKAP1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/NCKAP1-Antibody-Immunohistochemistry-Paraffin-NBP1-83269-img0009.jpg "Immunohistochemistry-Paraffin: NCKAP1 Antibody [NBP1-83269] - Staining in human cerebral cortex and skeletal muscle tissues using anti-NCKAP1 antibody. Corresponding NCKAP1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: NCKAP1 Antibody [NBP1-83269] - Staining of human cerebral cortex shows high expression.](http://images.novusbio.com/fullsize/NCKAP1-Antibody-Immunohistochemistry-Paraffin-NBP1-83269-img0007.jpg "Immunohistochemistry-Paraffin: NCKAP1 Antibody [NBP1-83269] - Staining of human cerebral cortex shows high expression.")
![Immunohistochemistry-Paraffin: NCKAP1 Antibody [NBP1-83269] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/NCKAP1-Antibody-Immunohistochemistry-Paraffin-NBP1-83269-img0008.jpg "Immunohistochemistry-Paraffin: NCKAP1 Antibody [NBP1-83269] - Staining of human skeletal muscle shows low expression as expected.")
![Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Angiopoietinlike_Protein_2_AF1444_Western_Blot_19840.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")