MYST1 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHE |
Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
KAT8 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for MYST1 Antibody
Background
The MYST family of histone acetyltransferases, which includes MYST1, is named for the founding members MOZ (MYST3; MIM 601408), yeast YBF2 and SAS2, and TIP60 (HTATIP; MIM 601409). All members of this family contain a MYST region of about 240 amino acids with a canonical acetyl-CoA-binding site and a C2HC-type zinc finger motif. Most MYST proteins also have a chromodomain involved in protein-protein interactions and targeting transcriptional regulators to chromatin (Neal et al., 2000).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF
Publications for MYST1 Antibody (NBP2-56864) (0)
There are no publications for MYST1 Antibody (NBP2-56864).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MYST1 Antibody (NBP2-56864) (0)
There are no reviews for MYST1 Antibody (NBP2-56864).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MYST1 Antibody (NBP2-56864) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MYST1 Products
Research Areas for MYST1 Antibody (NBP2-56864)
Find related products by research area.
|
Blogs on MYST1