![Western Blot: Myosin Light Chain 2 Antibody (5M6Q8) [NBP3-16693] - Western blot analysis of extracts of various cell lines, using Myosin Light Chain 2 Rabbit mAb (NBP3-16693) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.](http://images.novusbio.com/fullsize/Myosin-Light-Chain-2-Antibody-5M6Q8-Western-Blot-NBP3-16693-img0003.jpg "Western Blot: Myosin Light Chain 2 Antibody (5M6Q8) [NBP3-16693] - Western blot analysis of extracts of various cell lines, using Myosin Light Chain 2 Rabbit mAb (NBP3-16693) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.")
| Reactivity | Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | 5M6Q8 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 67-166 of human Myosin Light Chain 2 (P10916). DEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | MYL2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry MYH7 Antibody (940906) [Unconjugated]](https://images.novusbio.com/images2/MYH7_MAB9096_Immunohistochemistry_19508.jpg)
![Western Blot MYH7 Antibody (940906) [Unconjugated]](https://images.novusbio.com/images2/MYH7_MAB9096_Western_Blot_19525.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MYL2 |
![Immunohistochemistry: Myosin Light Chain 2 Antibody (5M6Q8) [NBP3-16693] - Immunofluorescence analysis of mouse heart using Myosin Light Chain 2 Rabbit mAb (NBP3-16693) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Myosin-Light-Chain-2-Antibody-5M6Q8-Immunohistochemistry-NBP3-16693-img0002.jpg "Immunohistochemistry: Myosin Light Chain 2 Antibody (5M6Q8) [NBP3-16693] - Immunofluorescence analysis of mouse heart using Myosin Light Chain 2 Rabbit mAb (NBP3-16693) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry: Myosin Light Chain 2 Antibody (5M6Q8) [NBP3-16693] - Immunofluorescence analysis of rat heart using Myosin Light Chain 2 Rabbit mAb (NBP3-16693) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Myosin-Light-Chain-2-Antibody-5M6Q8-Immunohistochemistry-NBP3-16693-img0001.jpg "Immunohistochemistry: Myosin Light Chain 2 Antibody (5M6Q8) [NBP3-16693] - Immunofluorescence analysis of rat heart using Myosin Light Chain 2 Rabbit mAb (NBP3-16693) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22971.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22972.jpg)
![Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunocytochemistry_9890.jpg)
![Western Blot NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-4120241239327.jpg)
![Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-41202412401270.jpg)
![Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-41202412403531.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")