![Immunohistochemistry-Paraffin: Myosin IF Antibody [NBP2-31598] - Staining of human spleen shows high expression.](http://images.novusbio.com/fullsize/Myosin-IF-Antibody-Immunohistochemistry-Paraffin-NBP2-31598-img0003.jpg "Immunohistochemistry-Paraffin: Myosin IF Antibody [NBP2-31598] - Staining of human spleen shows high expression.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RTLTVSVGDGLPKSSKPTRKGMAKGKPRRSSQAPTRAAPAPPRGMDRNGVPPSARGGPLPLEIMSGG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MYO1F |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: Myosin IF Antibody [NBP2-31598] - Staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.](http://images.novusbio.com/fullsize/Myosin-IF-Antibody-Immunohistochemistry-NBP2-31598-img0001.jpg "Immunohistochemistry: Myosin IF Antibody [NBP2-31598] - Staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.")
![Immunohistochemistry-Paraffin: Myosin IF Antibody [NBP2-31598] - Staining of human cerebral cortex shows low expression as expected.](http://images.novusbio.com/fullsize/Myosin-IF-Antibody-Immunohistochemistry-Paraffin-NBP2-31598-img0002.jpg "Immunohistochemistry-Paraffin: Myosin IF Antibody [NBP2-31598] - Staining of human cerebral cortex shows low expression as expected.")
![Immunohistochemistry-Paraffin: Myosin IF Antibody [NBP2-31598] - Staining in human spleen and cerebral cortex tissues using anti-MYO1F antibody. Corresponding MYO1F RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Myosin-IF-Antibody-Immunohistochemistry-Paraffin-NBP2-31598-img0004.jpg "Immunohistochemistry-Paraffin: Myosin IF Antibody [NBP2-31598] - Staining in human spleen and cerebral cortex tissues using anti-MYO1F antibody. Corresponding MYO1F RNA-seq data are presented for the same tissues.")
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22971.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22972.jpg)
![Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunocytochemistry_9890.jpg)
![Western Blot ID1 Antibody [Unconjugated]](https://images.novusbio.com/images2/ID1_AF4377_Western_Blot_5453.jpg)
![Immunocytochemistry ID1 Antibody [Unconjugated]](https://images.novusbio.com/images2/ID1_AF4377_Immunocytochemistry_12849.jpg)
![Simple Western ID1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af4377_human-mouse-id1-affinity-purified-polyclonal-ab-simple-western-482021152036.jpg)
![Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]](https://images.novusbio.com/images2/Integrin_beta_2_AF1730_Immunocytochemistry_6474.jpg)
![Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1730_human-integrin-beta-2-cd18-affinity-purified-polyclonal-ab-immunocytochemistry-1292023225343.jpg)
![Immunohistochemistry Integrin alpha 9 Antibody [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_9_AF3827_Immunohistochemistry_24134.jpg)
![Immunocytochemistry/ Immunofluorescence Integrin alpha 9 Antibody [Unconjugated]](https://images.novusbio.com/images/af3827_mouse-integrin-alpha-9-affinity-purified-polyclonal-ab-41202412394961.jpg)
![Immunocytochemistry/ Immunofluorescence Integrin alpha 9 Antibody [Unconjugated]](https://images.novusbio.com/images/af3827_mouse-integrin-alpha-9-affinity-purified-polyclonal-ab-41202412402515.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")