Myosin heavy chain 11 Antibody (0O4O4) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1160-1313 of human Myosin heavy chain 11 (NP_002465.1). DSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASL |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
MYH11 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunohistochemistry 1:2000 - 1:10000
- Immunohistochemistry-Paraffin 1:2000 - 1:10000
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
Preservative |
0.05% Proclin 300 |
Purity |
Affinity purified |
Alternate Names for Myosin heavy chain 11 Antibody (0O4O4)
Background
The protein encoded by the MYH11 gene is a smooth muscle myosin belonging to the myosin heavy chain family. The gene product is a subunit of a hexameric protein that consists of two heavy chain subunits and two pairs of non-identical light chain subunits. MYH11 functions as a major contractile protein, converting chemical energy into mechanical energy through the hydrolysis of ATP. The gene encoding a human ortholog of rat NUDE1 is transcribed from the reverse strand of this gene, and its 3' end overlaps with that of the latter. The pericentric inversion of chromosome 16 [inv(16)(p13q22)] produces a chimeric transcript that encodes a protein consisting of the first 165 residues from the N terminus of core-binding factor beta in a fusion with the C-terminal portion of the smooth muscle myosin heavy chain. This chromosomal rearrangement is associated with acute myeloid leukemia of the M4Eo subtype. Alternative splicing generates isoforms that are differentially expressed, with ratios changing during muscle cell maturation. Alternatively spliced transcript variants encoding different isoforms have been identified.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, PLA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, PEP-ELISA, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Dr, Hu, Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: CyTOF-ready, Flow
Publications for Myosin heavy chain 11 Antibody (NBP3-16323) (0)
There are no publications for Myosin heavy chain 11 Antibody (NBP3-16323).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Myosin heavy chain 11 Antibody (NBP3-16323) (0)
There are no reviews for Myosin heavy chain 11 Antibody (NBP3-16323).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Myosin heavy chain 11 Antibody (NBP3-16323) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Myosin heavy chain 11 Products
Research Areas for Myosin heavy chain 11 Antibody (NBP3-16323)
Find related products by research area.
|
Blogs on Myosin heavy chain 11