![Immunohistochemistry-Paraffin: MYLK2 Antibody [NBP2-32497] - Staining of human skeletal muscle shows high expression.](http://images.novusbio.com/fullsize/MYLK2-Antibody-Immunohistochemistry-Paraffin-NBP2-32497-img0007.jpg "Immunohistochemistry-Paraffin: MYLK2 Antibody [NBP2-32497] - Staining of human skeletal muscle shows high expression.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SPAFLHSPSCPAIISSSEKLLAKKPPSEASELTFEGVPMTHSPTDPRPAKAEEGKNILAESQKEVGEKTPGQAGQAKMQGD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MYLK2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-32497 | Applications | Species |
|---|---|---|
| Ding L, Wang L, Sui L et al. Claudin-7 indirectly regulates the integrin/FAk signaling pathway in human colon cancer tissue. J. Hum. Genet. 2016-04-28 [PMID: 27121327] (IHC-P, Human) | IHC-P | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for MYLK2 Antibody (NBP2-32497)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MYLK2 |
![Immunohistochemistry-Paraffin: MYLK2 Antibody [NBP2-32497] - Staining of human heart muscle shows low expression as expected.](http://images.novusbio.com/fullsize/MYLK2-Antibody-Immunohistochemistry-Paraffin-NBP2-32497-img0006.jpg "Immunohistochemistry-Paraffin: MYLK2 Antibody [NBP2-32497] - Staining of human heart muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: MYLK2 Antibody [NBP2-32497] - Staining in human skeletal muscle and heart muscle tissues using anti-MYLK2 antibody. Corresponding MYLK2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/MYLK2-Antibody-Immunohistochemistry-Paraffin-NBP2-32497-img0008.jpg "Immunohistochemistry-Paraffin: MYLK2 Antibody [NBP2-32497] - Staining in human skeletal muscle and heart muscle tissues using anti-MYLK2 antibody. Corresponding MYLK2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22971.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22972.jpg)
![Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunocytochemistry_9890.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot MRCL3 [p Ser19, p Ser20] Antibody](https://images.novusbio.com/images/MRCL3-[p-Ser19--p-Ser20]-Antibody-Western-Blot-NB100-1687-img0019.jpg)
![Immunohistochemistry MRCL3 [p Ser19, p Ser20] Antibody](https://images.novusbio.com/images/nb100-1687_rabbit-polyclonal-mrcl3-p-ser19-p-ser20-antibody-23520231814583.jpg)
![Immunohistochemistry MRCL3 [p Ser19, p Ser20] Antibody](https://images.novusbio.com/images/nb100-1687_rabbit-polyclonal-mrcl3-p-ser19-p-ser20-antibody-235202318143193.jpg)
![Immunohistochemistry Integrin alpha 9 Antibody [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_9_AF3827_Immunohistochemistry_24134.jpg)
![Immunocytochemistry/ Immunofluorescence Integrin alpha 9 Antibody [Unconjugated]](https://images.novusbio.com/images/af3827_mouse-integrin-alpha-9-affinity-purified-polyclonal-ab-41202412394961.jpg)
![Immunocytochemistry/ Immunofluorescence Integrin alpha 9 Antibody [Unconjugated]](https://images.novusbio.com/images/af3827_mouse-integrin-alpha-9-affinity-purified-polyclonal-ab-41202412402515.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")