| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1094-1203 of Human MTR Source: Wheat Germ (in vitro) Amino Acid Sequence: RDYLGLFAVACFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEELHERVRRELWAYCGSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Recombinant Protein |
| Gene | MTR |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Theoretical MW | 37.84 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
Research Areas for MTR Partial Recombinant Protein (H00004548-Q01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MTR |
![Western Blot: MTR Antibody [NB100-791] - Cgl null mice exhibit female-specific alteration of enzymes involved in the remethylation of methionine. Western blotting analysis of hepatic BHMT, MTHFR and MTR protein expression levels in male and female WT and Cgl null mice. Values shown represent the mean+-s.d., *Pless than 0.05, **Pless than 0.01, ***Pless than 0.001. Image collected and cropped by CiteAb from the following publication (//bio.biologists.org/cgi/doi/10.1242/bio.013433) licensed under a CC-BY license.](https://images.novusbio.com/images/MTR-Antibody-Western-Blot-NB100-791-img0003.jpg "Western Blot: MTR Antibody [NB100-791] - Cgl null mice exhibit female-specific alteration of enzymes involved in the remethylation of methionine. Western blotting analysis of hepatic BHMT, MTHFR and MTR protein expression levels in male and female WT and Cgl null mice. Values shown represent the mean+-s.d., *Pless than 0.05, **Pless than 0.01, ***Pless than 0.001. Image collected and cropped by CiteAb from the following publication (//bio.biologists.org/cgi/doi/10.1242/bio.013433) licensed under a CC-BY license.")