![Western Blot: MPPED2 Antibody [H00000744-B01P] - Analysis of MPPED2 expression in rat brain.](http://images.novusbio.com/fullsize/MPPED2-Antibody-Western-Blot-H00000744-B01P-img0003.jpg "Western Blot: MPPED2 Antibody [H00000744-B01P] - Analysis of MPPED2 expression in rat brain.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | MPPED2 (NP_001575.1, 1 a.a. - 294 a.a.) full-length human protein. MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS |
| Specificity | MPPED2 - metallophosphoesterase domain containing 2, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | MPPED2 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
![Immunocytochemistry HGFR/c-MET Antibody [Unconjugated]](https://images.novusbio.com/images2/HGF_R_AF276_Immunocytochemistry__Immunofluorescence_21675.jpg)
![Immunohistochemistry HGFR/c-MET Antibody [Unconjugated]](https://images.novusbio.com/images2/HGF_R_AF276_Immunohistochemistry_6763.jpg)
![Knockout Validated HGFR/c-MET Antibody [Unconjugated]](https://images.novusbio.com/images2/HGF_R_AF276_Knockout_Validated_22522.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for MPPED2 Antibody (H00000744-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MPPED2 |
| Entrez |
|
| Uniprot |
|
![Western Blot: MPPED2 Antibody [H00000744-B01P] - Analysis of MPPED2 expression in transfected 293T cell line by MPPED2 polyclonal antibody. Lane 1: MPPED2 transfected lysate(32.34 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/MPPED2-Antibody-Western-Blot-H00000744-B01P-img0004.jpg "Western Blot: MPPED2 Antibody [H00000744-B01P] - Analysis of MPPED2 expression in transfected 293T cell line by MPPED2 polyclonal antibody. Lane 1: MPPED2 transfected lysate(32.34 KDa). Lane 2: Non-transfected lysate.")
![Simple Western Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Simple_Western_17126.jpg)
![Immunocytochemistry Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Immunocytochemistry_14427.jpg)
![Western Blot Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Western_Blot_14743.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")