![Immunohistochemistry-Paraffin: Moesin Antibody [NBP1-90373] -Analysis in human lung and skeletal muscle tissues using NBP1-90373 antibody. Corresponding MSN RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/antibody/nbp1-90373_rabbit-polyclonal-moesin-antibody-immunohistochemistry-paraffin-59202483449..jpg "Immunohistochemistry-Paraffin: Moesin Antibody [NBP1-90373] -Analysis in human lung and skeletal muscle tissues using NBP1-90373 antibody. Corresponding MSN RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KKAQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MSN |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Simple_Western_21377.jpg)
![Western Blot CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Western_Blot_21459.jpg)
![Immunohistochemistry CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Immunohistochemistry_17361.jpg)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Moesin Antibody (NBP1-90373)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MSN |
![Western Blot: Moesin Antibody [NBP1-90373] - Analysis using Anti-MSN antibody NBP1-90373 (A) shows similar pattern to independent antibody NBP1-90372 (B).](http://images.novusbio.com/fullsize/Moesin-Antibody-Western-Blot-NBP1-90373-img0016.jpg "Western Blot: Moesin Antibody [NBP1-90373] - Analysis using Anti-MSN antibody NBP1-90373 (A) shows similar pattern to independent antibody NBP1-90372 (B).")
![Immunocytochemistry/Immunofluorescence: Moesin Antibody [NBP1-90373] - Staining of human cell line U-251 MG shows localization to plasma membrane.](http://images.novusbio.com/fullsize/Moesin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90373-img0013.jpg "Immunocytochemistry/Immunofluorescence: Moesin Antibody [NBP1-90373] - Staining of human cell line U-251 MG shows localization to plasma membrane.")
![Western Blot: Moesin Antibody [NBP1-90373] - Analysis in human cell lines U-251MG and MCF-7 using anti-MSN antibody. Corresponding MSN RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.](http://images.novusbio.com/fullsize/Moesin-Antibody-Western-Blot-NBP1-90373-img0015.jpg "Western Blot: Moesin Antibody [NBP1-90373] - Analysis in human cell lines U-251MG and MCF-7 using anti-MSN antibody. Corresponding MSN RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.")
![Immunohistochemistry-Paraffin: Moesin Antibody [NBP1-90373] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/Moesin-Antibody-Immunohistochemistry-Paraffin-NBP1-90373-img0010.jpg "Immunohistochemistry-Paraffin: Moesin Antibody [NBP1-90373] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: Moesin Antibody [NBP1-90373] - Staining of human tonsil shows high expression.](http://images.novusbio.com/fullsize/Moesin-Antibody-Immunohistochemistry-Paraffin-NBP1-90373-img0011.jpg "Immunohistochemistry-Paraffin: Moesin Antibody [NBP1-90373] - Staining of human tonsil shows high expression.")
![Immunohistochemistry-Paraffin: Moesin Antibody [NBP1-90373] -Staining of human lung shows moderate membranous positivity in macrophages.](http://images.novusbio.com/fullsize/antibody/nbp1-90373_rabbit-polyclonal-moesin-antibody-immunohistochemistry-paraffin-59202483617..jpg "Immunohistochemistry-Paraffin: Moesin Antibody [NBP1-90373] -Staining of human lung shows moderate membranous positivity in macrophages.")
![Western Blot: Moesin Antibody [NBP1-90373] -Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/antibody/nbp1-90373_rabbit-polyclonal-moesin-antibody-western-blot-59202483731..jpg "Western Blot: Moesin Antibody [NBP1-90373] -Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Immunohistochemistry FAK Antibody [Unconjugated]](https://images.novusbio.com/images2/FAK_AF4467_Immunohistochemistry_6835.jpg)
![Knockout Validated FAK Antibody [Unconjugated]](https://images.novusbio.com/images2/FAK_AF4467_Knockout_Validated_22783.jpg)
![Western Blot FAK Antibody [Unconjugated]](https://images.novusbio.com/images2/af4467_human-mouse-rat-fak-affinity-purified-polyclonal-ab-western-blot-116202015471.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")