MLX Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: EEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSA |
Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MLX |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for MLX Antibody
Background
Max is a nuclear localized bHLH-Zip protein that forms homodimers or heterodimers with Myc family members, including Myc, Mad 1, Mad 3, Mad 4, Mxi1 and Mnt (or Rox). These dimers bind to the E-box sequence CACGTG in order to regulate cell growth, proliferation and apoptosis. Mlx (Max-like protein X) is a bHLH-Zip protein that is structurally and functionally related to Max. Like Max, Mlx is broadly expressed in many tissues and has a long half-life. Mlx also forms homodimers or heterodimers with members of the Myc family, specifically Mad 1, Mad 4 and Rox, and members of the Mondo family, to repress or activate transcription from CACGTG E-boxes. MondoA forms weak homodimers and preferentially forms heterodimers with Mlx. The MondoA/Mlx complex is primarily localized to the cytoplasm, but will translocate to the nucleus in response to leptomycin B. Mlx can also dimerize with WBSCR14, a protein involved in Williams-Beuren syndrome (WBS), to repress E-box transcription, which provides further evidence that Mlx is a critical element in a transcription factor network.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: ChIP, ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, GS, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, PAGE, WB
Species: Hu
Applications: IHC, IP, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ha, Hu, Pm, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
Publications for MLX Antibody (NBP2-37937) (0)
There are no publications for MLX Antibody (NBP2-37937).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MLX Antibody (NBP2-37937) (0)
There are no reviews for MLX Antibody (NBP2-37937).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for MLX Antibody (NBP2-37937) (0)