Home » MLLT1 » MLLT1 Proteins » MLLT1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MLLT1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MLLT1 Protein (NBP1-84840PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MLLT1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MLLT1.

Source: E. coli

Amino Acid Sequence: MVMPEGADTVSRPSPDYPMLPTIPLSAFSDPKKTKPSHGSKDANKESSKTSKPHKVTKEHRERPRKDSESKSSSKELEREQAKSSKDTSRKLGEGRLPKEEKAPPPKAAFKEPKMALKE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MLLT1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84840.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MLLT1 Recombinant Protein Antigen

  • ENLENL/MLL fusion
  • LTG19MLLT1/MLL fusion
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 1
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 1
  • protein ENL
  • YEATS domain-containing protein 1
  • YEATS1myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog); translocatedto, 1

Background

MLLT1, also known as ENL (eleven nineteen leukemia protein), was originally identified as a gene involved in a recurrent translocation (11;19) with the mixed-lineage leukemia (MLL) gene. The MLL-ENL fusion protein has been found to associate with SWI/SNF complexes and promote transcription from the HoxA7 promoter. Additionally, from studies to identify proteins that associate with MLLT1, MLLT1 is suggested to play a role in histone modification and transcriptional elongation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF9 Antibody
NBP2-15303
Immunocytochemistry/ Immunofluorescence AF9 Antibody
Western Blot AF9 Antibody
Immunohistochemistry-Paraffin AF9 Antibody
(3 Publications)
Species: Hu, Mu
Applications: CHIP-SEQ, ICC/IF, IHC, IHC-P, WB
AF4 Antibody
NBP1-28728
Immunohistochemistry-Paraffin AF4 Antibody
Western Blot AF4 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, IP (-), WB
ELL Antibody
NBP2-82991
Western Blot ELL Antibody
Immunohistochemistry-Paraffin ELL Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Exosome component
1 Antibody (OTI1H9)
NBP2-45545
Immunohistochemistry Exosome component 1 Antibody (OTI1H9)
Immunohistochemistry Exosome component 1 Antibody (OTI1H9)
Immunohistochemistry Exosome component 1 Antibody (OTI1H9)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
AF10 Antibody
NBP1-90222
Immunohistochemistry-Paraffin AF10 Antibody
Immunocytochemistry/ Immunofluorescence AF10 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Afadin/AF-6
Antibody [Unconjugate
AF7829
Western Blot Afadin/AF-6 Antibody [Unconjugated]
Immunohistochemistry Afadin/AF-6 Antibody [Unconjugated]
Immunocytochemistry Afadin/AF-6 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: ICC, IHC, WB
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(302 Publications)
Species: Mu
Applications: ELISA
c-Abl Antibody
[Unconjugated]
AF5414
Western Blot c-Abl Antibody [Unconjugated]
Simple Western c-Abl Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: Simple Western, WB
DOT1L Antibody
NB100-40845
Chromatin Immunoprecipitation DOT1L Antibody
Immunohistochemistry-Paraffin DOT1L Antibody
Western Blot DOT1L Antibody
(13 Publications)
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC, IHC-P, IP, KD, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(667 Publications)
Species: Mu
Applications: ELISA
AFF4 Antibody
(2E12)
H00027125-M01
Immunohistochemistry-Paraffin AFF4 Antibody (2E12)
Western Blot AFF4 Antibody (2E12)
Sandwich ELISA AFF4 Antibody (2E12)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
SNF5 Antibody
(3E10)
H00006598-M01
ELISA SNF5 Antibody (3E10)
Immunohistochemistry-Paraffin SNF5 Antibody (3E10)
Western Blot SNF5 Antibody (3E10)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
SMARCA1 Antibody
(2H7B8) - BSA Free
NBP2-61879
ELISA SMARCA1 Antibody (2H7B8) - BSA Free
Flow Cytometry SMARCA1 Antibody (2H7B8) - BSA Free
Immunohistochemistry SMARCA1 Antibody (2H7B8) - BSA Free
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
C-Reactive
Protein/CRP [Biotin]
DY1707
N/A C-Reactive Protein/CRP [Biotin]
(70 Publications)
Species: Hu
Applications: ELISA
MLLT6 Antibody
NBP1-89222
Immunohistochemistry-Paraffin MLLT6 Antibody
Immunocytochemistry/ Immunofluorescence MLLT6 Antibody
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
GAS41 Antibody
NBP3-38243
Western Blot GAS41 Antibody
Immunohistochemistry GAS41 Antibody
Immunocytochemistry/ Immunofluorescence GAS41 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Cdk9 Antibody
(1C4E3)
NBP3-15345
Immunohistochemistry-Paraffin Cdk9 Antibody (1C4E3)
Immunohistochemistry-Paraffin Cdk9 Antibody (1C4E3)
Immunohistochemistry-Paraffin Cdk9 Antibody (1C4E3)
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ELISA, ICC/IF, IHC, IHC-P, IP, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
MLLT1 Recombinant
Protein Antigen
NBP1-84840PEP
MLLT1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for MLLT1 Protein (NBP1-84840PEP) (0)

There are no publications for MLLT1 Protein (NBP1-84840PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MLLT1 Protein (NBP1-84840PEP) (0)

There are no reviews for MLLT1 Protein (NBP1-84840PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MLLT1 Protein (NBP1-84840PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MLLT1 Products

Array NBP1-84840PEP

Blogs on MLLT1

There are no specific blogs for MLLT1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
As an alternative, please consider our next generation Recombinant Human IL-2 (BT-002). It has equivalent bioactivity to Recombinant Human IL-2 (Catalog # 202-IL). It combines R&D Systems quality with scalability that allows for a solid supply chain. Both Recombinant Human IL-2 proteins are measured in a cell proliferation assay using CTLL 2 mouse cytotoxic T cells.
IL-2 [Unconjugated]
202-IL-010

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MLLT1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MLLT1