Home » MEKK2 » MEKK2 Proteins » Recombinant Human MEKK2 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human MEKK2 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human MEKK2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 111-200 of Human MEKK2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: HMKSLKILLVINGSTQATNLEPLPSLEDLDNTVFGAERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPESMEQM
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
MAP3K2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
35.53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MEKK2 GST (N-Term) Protein

  • EC 2.7.11.25
  • MAP/ERK kinase kinase 2
  • MAP3K2
  • MAPK/ERK kinase kinase 2
  • MAPKKK2
  • MEK kinase 2
  • MEKK 2
  • MEKK2
  • MEKK2B
  • mitogen-activated protein kinase kinase kinase 2

Background

MAP3K2 - mitogen-activated protein kinase kinase kinase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ERK5/BMK1 Antibody
[Unconjugated]
AF2848
Western Blot ERK5/BMK1 Antibody [Unconjugated]
Immunocytochemistry ERK5/BMK1 Antibody [Unconjugated]
(4 Publications)
Species: Hu, Mu
Applications: ICC, WB
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western Blot JNK1 Antibody (228601) [Unconjugated]
Western Blot JNK1 Antibody (228601) [Unconjugated]
Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
MEKK1 Antibody -
Azide and BSA Free
NBP3-02962
Immunocytochemistry/ Immunofluorescence MEKK1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin MEKK1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin MEKK1 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MEKK3 Antibody
(576240) [Unconjugate
MAB6095
Knockout Validated MEKK3 Antibody (576240) [Unconjugated]
Western Blot MEKK3 Antibody (576240) [Unconjugated]
Species: Hu
Applications: KO, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
MEK5 Antibody
NBP1-89654
Western Blot MEK5 Antibody
Immunohistochemistry-Paraffin MEK5 Antibody
Immunohistochemistry-Paraffin MEK5 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
MKK7/MEK7 Antibody
(4E5) - BSA Free
NBP2-37542
ELISA MKK7/MEK7 Antibody (4E5) - BSA Free
Western Blot MKK7/MEK7 Antibody (4E5) - BSA Free
Immunocytochemistry/ Immunofluorescence MKK7/MEK7 Antibody (4E5) - BSA Free
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
MKK4/MEK4 Antibody
(OTI8A8)
NBP1-47839
Flow Cytometry MKK4/MEK4 Antibody (OTI8A8)
Immunocytochemistry/ Immunofluorescence MKK4/MEK4 Antibody (OTI8A8)
Immunocytochemistry/ Immunofluorescence MKK4/MEK4 Antibody (OTI8A8)
(1 Review)
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(62 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(843 Publications)
Species: Hu
Applications: BA
p38 alpha Antibody
[Unconjugated]
AF8691
Simple Western p38 alpha Antibody [Unconjugated]
Western Blot p38 alpha Antibody [Unconjugated]
Immunohistochemistry p38 alpha Antibody [Unconjugated]
(1 Review)
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
SGSM3 Antibody
NBP2-13304
Immunohistochemistry-Paraffin SGSM3 Antibody
Immunocytochemistry/ Immunofluorescence SGSM3 Antibody
Western Blot SGSM3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Crk Antibody
(3G11E8) - BSA Free
NBP2-37568
ELISA Crk Antibody (3G11E8) - BSA Free
Western Blot Crk Antibody (3G11E8) - BSA Free
Western Blot Crk Antibody (3G11E8) - BSA Free
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
GRAP2 Antibody
(OTI1G2)
NBP2-00764
Flow Cytometry GRAP2 Antibody (OTI1G2)
Flow Cytometry GRAP2 Antibody (OTI1G2)
Western Blot GRAP2 Antibody (OTI1G2)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
AIMP2 Antibody
NBP1-81575
Immunohistochemistry-Paraffin AIMP2 Antibody
Immunohistochemistry-Paraffin AIMP2 Antibody
Immunohistochemistry-Paraffin AIMP2 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for MEKK2 Partial Recombinant Protein (H00010746-Q01) (0)

There are no publications for MEKK2 Partial Recombinant Protein (H00010746-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEKK2 Partial Recombinant Protein (H00010746-Q01) (0)

There are no reviews for MEKK2 Partial Recombinant Protein (H00010746-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MEKK2 Partial Recombinant Protein (H00010746-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MEKK2 Products

Research Areas for MEKK2 Partial Recombinant Protein (H00010746-Q01)

Find related products by research area.

Blogs on MEKK2

There are no specific blogs for MEKK2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MEKK2 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol MAP3K2