![Western Blot: MED4 Antibody [NBP1-84977] - Components from all modules of Mediator are found in TAP-wtICP4 samples. Western blot analysis of nuclear extracts (NE) or affinity purified (PD) samples using either wtICP4 (KOS) or TAP-wtICP4 (TAP) expressing viruses at 6 hpi. Results of the Western blot analysis for components of the head (Med6), middle (Med4 and Med1), tail (Med23), kinase (cdk8, Med12, and Med13), and the Med26 protein are shown. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0078242), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/MED4-Antibody-Western-Blot-NBP1-84977-img0008.jpg "Western Blot: MED4 Antibody [NBP1-84977] - Components from all modules of Mediator are found in TAP-wtICP4 samples. Western blot analysis of nuclear extracts (NE) or affinity purified (PD) samples using either wtICP4 (KOS) or TAP-wtICP4 (TAP) expressing viruses at 6 hpi. Results of the Western blot analysis for components of the head (Med6), middle (Med4 and Med1), tail (Med23), kinase (cdk8, Med12, and Med13), and the Med26 protein are shown. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0078242), licensed under a CC-BY license.")
| Reactivity | Hu, Pm, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQI |
| Predicted Species | Mouse (90%), Rat (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MED4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | WB reported in scientific literature (PMID: 24147125). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for MED4 Antibody (NBP1-84977)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MED4 |
![Immunocytochemistry/Immunofluorescence: MED4 Antibody [NBP1-84977] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/MED4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84977-img0006.jpg "Immunocytochemistry/Immunofluorescence: MED4 Antibody [NBP1-84977] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: MED4 Antibody [NBP1-84977] - Staining of human Placenta shows strong nuclear positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/MED4-Antibody-Immunohistochemistry-Paraffin-NBP1-84977-img0011.jpg "Immunohistochemistry-Paraffin: MED4 Antibody [NBP1-84977] - Staining of human Placenta shows strong nuclear positivity in trophoblastic cells.")
![Western Blot: MED4 Antibody [NBP1-84977] - Analysis in control (vector only transfected HEK293T lysate) and MED4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/MED4-Antibody-Western-Blot-NBP1-84977-img0007.jpg "Western Blot: MED4 Antibody [NBP1-84977] - Analysis in control (vector only transfected HEK293T lysate) and MED4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: MED4 Antibody [NBP1-84977] - Staining of human stomach shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/MED4-Antibody-Immunohistochemistry-Paraffin-NBP1-84977-img0002.jpg "Immunohistochemistry-Paraffin: MED4 Antibody [NBP1-84977] - Staining of human stomach shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: MED4 Antibody [NBP1-84977] - Staining of human Cerebral cortex shows strong nuclear positivity in neuronal cells.](http://images.novusbio.com/fullsize/MED4-Antibody-Immunohistochemistry-Paraffin-NBP1-84977-img0009.jpg "Immunohistochemistry-Paraffin: MED4 Antibody [NBP1-84977] - Staining of human Cerebral cortex shows strong nuclear positivity in neuronal cells.")
![Immunohistochemistry-Paraffin: MED4 Antibody [NBP1-84977] - Staining of human Lymph node shows moderate nuclear positivity in non-germinal center and germinal center cells.](http://images.novusbio.com/fullsize/MED4-Antibody-Immunohistochemistry-Paraffin-NBP1-84977-img0010.jpg "Immunohistochemistry-Paraffin: MED4 Antibody [NBP1-84977] - Staining of human Lymph node shows moderate nuclear positivity in non-germinal center and germinal center cells.")
![Immunohistochemistry-Paraffin: MED4 Antibody [NBP1-84977] - Staining of human Testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/MED4-Antibody-Immunohistochemistry-Paraffin-NBP1-84977-img0012.jpg "Immunohistochemistry-Paraffin: MED4 Antibody [NBP1-84977] - Staining of human Testis shows strong nuclear positivity in cells in seminiferous ducts.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![N/A CD40 Ligand/TNFSF5 [HRP]](https://images.novusbio.com/images2/CD40_Ligand_DCDL40_ELISA_60.jpg)
![N/A CD40 Ligand/TNFSF5 [HRP]](https://images.novusbio.com/images2/DATA_CD40_Ligand_DCDL40_ELISA_624.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")