Home » MAP3K12 » MAP3K12 Proteins » MAP3K12 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MAP3K12 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MAP3K12 Recombinant Protein Antigen (NBP2-58000PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MAP3K12 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAP3K12.

Source: E. coli

Amino Acid Sequence: LLHGNTMEKLIKKRNVPQKLSPHSKRPDILKTESLLPKLDAALSGVGLPGCPKGPPSPGRSRRGKTRHRKASAKGSCGDL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MAP3K12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58000.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MAP3K12 Recombinant Protein Antigen

  • DLKEC 2.7.11.25
  • Dual leucine zipper bearing kinase
  • EC 2.7.11
  • Leucine-zipper protein kinase
  • MAPK-upstream kinase
  • MEKK12
  • mitogen-activated protein kinase kinase kinase 12
  • Mixed lineage kinase
  • MUKdual leucine zipper kinase DLK
  • protein kinase MUK
  • ZPKleucine zipper protein kinase
  • ZPKP1

Background

The protein encoded by the MAP3K12 gene is a member of serine/threonine protein kinase family. This kinase contains a leucine-zipper domain, and is predominately expressed in neuronal cells. The phosphorylation state of this kinase in synaptic terminals was shown to be regulated by membrane depolarization via calcineurin. This kinase forms heterodimers with leucine zipper containing transcription factors, such as cAMP responsive element binding protein (CREB) and MYC, and thus may play a regulatory role in PKA or retinoic acid induced neuronal differentiation. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western Blot JNK1 Antibody (228601) [Unconjugated]
Western Blot JNK1 Antibody (228601) [Unconjugated]
Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
MAP3K13 Antibody
NBP1-81272
Western Blot MAP3K13 Antibody
Immunohistochemistry-Paraffin MAP3K13 Antibody
Immunohistochemistry-Paraffin MAP3K13 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Pref-1/DLK1/FA1
Antibody (211309)
MAB1144
Immunocytochemistry Pref-1/DLK1/FA1 Antibody (211309)
Flow Cytometry Pref-1/DLK1/FA1 Antibody (211309)
(1 Review)
(6 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
MKK4/MEK4 Antibody
(OTI8A8)
NBP1-47839
Flow Cytometry MKK4/MEK4 Antibody (OTI8A8)
Immunocytochemistry/ Immunofluorescence MKK4/MEK4 Antibody (OTI8A8)
Immunocytochemistry/ Immunofluorescence MKK4/MEK4 Antibody (OTI8A8)
(1 Review)
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
MLK3 Antibody
AF4559
Western Blot MLK3 Antibody
Species: Hu
Applications: WB
MKK7/MEK7 Antibody
(4E5) - BSA Free
NBP2-37542
ELISA MKK7/MEK7 Antibody (4E5) - BSA Free
Western Blot MKK7/MEK7 Antibody (4E5) - BSA Free
Immunocytochemistry/ Immunofluorescence MKK7/MEK7 Antibody (4E5) - BSA Free
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
SGSM3 Antibody
NBP2-13304
Immunohistochemistry-Paraffin SGSM3 Antibody
Immunocytochemistry/ Immunofluorescence SGSM3 Antibody
Western Blot SGSM3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
DAPK3/ZIPK
Antibody (4H4C8) - BS
NBP2-52452
ELISA DAPK3/ZIPK Antibody (4H4C8) - BSA Free
Western Blot DAPK3/ZIPK Antibody (4H4C8) - BSA Free
Western Blot DAPK3/ZIPK Antibody (4H4C8) - BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
MLK2 Antibody
AF5066
Western Blot MLK2 Antibody
(2 Publications)
Species: Hu
Applications: WB
JNK2 Antibody
(252320) [Unconjugate
MAB1846
Western Blot JNK2 Antibody (252320) [Unconjugated]
Knockout Validated JNK2 Antibody (252320) [Unconjugated]
Immunocytochemistry JNK2 Antibody (252320) [Unconjugated]
(2 Reviews)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
p38 alpha Antibody
[Unconjugated]
AF8691
Simple Western p38 alpha Antibody [Unconjugated]
Western Blot p38 alpha Antibody [Unconjugated]
Immunohistochemistry p38 alpha Antibody [Unconjugated]
(1 Review)
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(849 Publications)
Species: Hu
Applications: BA
DAP1 Antibody -
BSA Free
NBP2-92897
Immunocytochemistry/ Immunofluorescence DAP1 Antibody - BSA Free
Western Blot DAP1 Antibody - BSA Free
Immunohistochemistry-Paraffin DAP1 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Crk Antibody
(3G11E8) - BSA Free
NBP2-37568
ELISA Crk Antibody (3G11E8) - BSA Free
Western Blot Crk Antibody (3G11E8) - BSA Free
Western Blot Crk Antibody (3G11E8) - BSA Free
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
POLDIP2 Antibody
NBP1-68874
Western Blot POLDIP2 Antibody
Western Blot POLDIP2 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
AHSA1 Antibody
(1A2-A8)
H00010598-M01
Western Blot AHSA1 Antibody (1A2-A8)
Sandwich ELISA AHSA1 Antibody (1A2-A8)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB

Publications for MAP3K12 Recombinant Protein Antigen (NBP2-58000PEP) (0)

There are no publications for MAP3K12 Recombinant Protein Antigen (NBP2-58000PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAP3K12 Recombinant Protein Antigen (NBP2-58000PEP) (0)

There are no reviews for MAP3K12 Recombinant Protein Antigen (NBP2-58000PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MAP3K12 Recombinant Protein Antigen (NBP2-58000PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAP3K12 Products

Array NBP2-58000PEP

Research Areas for MAP3K12 Recombinant Protein Antigen (NBP2-58000PEP)

Find related products by research area.

Blogs on MAP3K12

There are no specific blogs for MAP3K12, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and NIH‑3T3 mouse embryonic fibroblast cell line, loaded at 0.2 mg/mL. A specific band was detected for p38 alpha at approximately 43 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat p38 alpha Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8691). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
p38 alpha Antibody [Unconjugated]
AF8691

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MAP3K12 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MAP3K12