Home » LTK » LTK Proteins » LTK Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

LTK Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for LTK Protein (NBP2-32475PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

LTK Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LTK.

Source: E. coli

Amino Acid Sequence: TQDPDVLNSLLPMELGPTPEEEGTSGLGNRSLECLRPPQPQELSPEKLKSWGGSPLGPWLSSGLKPLKS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LTK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32475.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LTK Recombinant Protein Antigen

  • EC 2.7.10.1
  • leukocyte receptor tyrosine kinase
  • leukocyte tyrosine kinase receptor
  • leukocyte tyrosine kinase
  • LTK
  • TYK1
  • TYK1Protein tyrosine kinase 1

Background

LTK is encoded by this gene is a member of the ros/insulin receptor family of tyrosine kinases. Tyrosine-specific phosphorylation of proteins is a key to the control of diverse pathways leading to cell growth and differentiation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Kv1.5 Antibody
NBP2-76939
Western Blot Kv1.5 Antibody
Immunocytochemistry/ Immunofluorescence Kv1.5 Antibody
Immunocytochemistry/ Immunofluorescence Kv1.5 Antibody
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
HO-1/HMOX1/HSP32
Antibody (HO-1-1)
NBP1-97507
Flow Cytometry HO-1/HMOX1/HSP32 Antibody (HO-1-1)
Immunohistochemistry-Paraffin HO-1/HMOX1/HSP32 Antibody (HO-1-1)
Western Blot HO-1/HMOX1/HSP32 Antibody (HO-1-1)
(1 Review)
(20 Publications)
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
alpha-Synuclein
Antibody
NBP2-15365
Immunohistochemistry-Frozen alpha-Synuclein Antibody
Immunohistochemistry-Frozen alpha-Synuclein Antibody
Immunocytochemistry/ Immunofluorescence alpha-Synuclein Antibody
(1 Review)
(12 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA, WB
ALK/CD246 Antibody
[Unconjugated]
AF4210
Western Blot ALK/CD246 Antibody [Unconjugated]
Immunohistochemistry ALK/CD246 Antibody [Unconjugated]
Simple Western ALK/CD246 Antibody [Unconjugated]
(1 Review)
Species: Hu
Applications: IHC, Simple Western, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
SLC6A3/DAT1
Antibody (mAb16)
NBP2-22164
Western Blot SLC6A3/DAT1 Antibody (mAb16)
Western Blot SLC6A3/DAT1 Antibody (mAb16)
Immunohistochemistry-Paraffin SLC6A3/DAT1 Antibody (mAb16)
(3 Reviews)
(14 Publications)
Species: Hu(-), Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
PLK3 Antibody
AF4197
Western Blot PLK3 Antibody
Species: Hu
Applications: WB
Transketolase
Antibody
NBP1-87441
Immunohistochemistry-Paraffin Transketolase Antibody
Immunocytochemistry/ Immunofluorescence Transketolase Antibody
Western Blot Transketolase Antibody
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Insulin Receptor
beta Antibody
NBP2-12793
Immunohistochemistry-Paraffin Insulin Receptor beta Antibody
Immunoprecipitation Insulin Receptor beta Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
IRS1 Antibody
NB100-82001
Immunohistochemistry-Paraffin IRS1 Antibody
Western Blot IRS1 Antibody
Immunocytochemistry/ Immunofluorescence IRS1 Antibody
(4 Publications)
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ACCN1 Antibody
NBP2-14321
Immunohistochemistry-Paraffin ACCN1 Antibody
Western Blot ACCN1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
SHC1 Antibody
(OTI3A1)
NBP2-02434
Western Blot SHC1 Antibody (OTI3A1)
Immunohistochemistry-Paraffin SHC1 Antibody (OTI3A1)
Immunohistochemistry-Paraffin SHC1 Antibody (OTI3A1)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Fucosyltransferase
2/FUT2
7770-GT
Fucosyltransferase 2/FUT2
(2 Publications)
Species: Hu
Applications: EnzAct
NPM1 Antibody -
BSA Free
NB110-61646
Immunocytochemistry/ Immunofluorescence NPM1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence NPM1 Antibody - BSA Free
Western Blot NPM1 Antibody - BSA Free
(2 Reviews)
(4 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
ITK Antibody
(HL1264) - Azide and ...
NBP3-25538
Immunocytochemistry/ Immunofluorescence ITK Antibody (HL1264) - Azide and BSA Free
Western Blot ITK Antibody (HL1264) - Azide and BSA Free
Immunohistochemistry-Paraffin ITK Antibody (HL1264) - Azide and BSA Free
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
SQLE Antibody -
Azide and BSA Free
NBP2-93808
Immunocytochemistry/ Immunofluorescence SQLE Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence SQLE Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence SQLE Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for LTK Protein (NBP2-32475PEP) (0)

There are no publications for LTK Protein (NBP2-32475PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LTK Protein (NBP2-32475PEP) (0)

There are no reviews for LTK Protein (NBP2-32475PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LTK Protein (NBP2-32475PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LTK Products

Research Areas for LTK Protein (NBP2-32475PEP)

Find related products by research area.

Blogs on LTK

There are no specific blogs for LTK, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

As an alternative, please consider our next generation Recombinant Human IL-2 (BT-002). It has equivalent bioactivity to Recombinant Human IL-2 (Catalog # 202-IL). It combines R&D Systems quality with scalability that allows for a solid supply chain. Both Recombinant Human IL-2 proteins are measured in a cell proliferation assay using CTLL 2 mouse cytotoxic T cells.
IL-2 [Unconjugated]
202-IL-010
Flow Cytometry: HO-1/HMOX1/HSP32 Antibody (HO-1-1) [NBP1-97507] - Analysis of 10^6 Jurkat cells stained using HO-1 monoclonal antibody (HO-1-1), (Prod. No. ADI-OSA-110), at a concentration of 50 ug/mL
HO-1/HMOX1/HSP32 Antibody (HO-1-1)
NBP1-97507-0.05mg

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LTK Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol LTK