![Western Blot: Lgl1 Antibody [NBP1-84077] - Analysis in human cell line U-251 MG.](http://images.novusbio.com/fullsize/Lgl1-Antibody-Western-Blot-NBP1-84077-img0006.jpg "Western Blot: Lgl1 Antibody [NBP1-84077] - Analysis in human cell line U-251 MG.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FERFSLSARNITEPLCSLDINWPRDATQASYRIRESPKLSQANGTPSILLAPQSLDGSPDPAHSMGPDTPEPPEAALSPMSIDSATSADTTLDTTGDVTVEDVKDFLGSSEESEKNLRNLAEDE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LLGL1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Theoretical MW | 115 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Lgl1 Antibody (NBP1-84077)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Lgl1 Antibody [NBP1-84077] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/Lgl1-Antibody-Immunohistochemistry-Paraffin-NBP1-84077-img0010.jpg "Immunohistochemistry-Paraffin: Lgl1 Antibody [NBP1-84077] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Lgl1 Antibody [NBP1-84077] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/Lgl1-Antibody-Immunohistochemistry-Paraffin-NBP1-84077-img0005.jpg "Immunohistochemistry-Paraffin: Lgl1 Antibody [NBP1-84077] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: Lgl1 Antibody [NBP1-84077] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in glial cells.](http://images.novusbio.com/fullsize/Lgl1-Antibody-Immunohistochemistry-Paraffin-NBP1-84077-img0007.jpg "Immunohistochemistry-Paraffin: Lgl1 Antibody [NBP1-84077] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in glial cells.")
![Immunohistochemistry-Paraffin: Lgl1 Antibody [NBP1-84077] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Lgl1-Antibody-Immunohistochemistry-Paraffin-NBP1-84077-img0008.jpg "Immunohistochemistry-Paraffin: Lgl1 Antibody [NBP1-84077] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Lgl1 Antibody [NBP1-84077] - Staining of human kidney shows weak cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/Lgl1-Antibody-Immunohistochemistry-Paraffin-NBP1-84077-img0009.jpg "Immunohistochemistry-Paraffin: Lgl1 Antibody [NBP1-84077] - Staining of human kidney shows weak cytoplasmic positivity in cells in tubules.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")