Home » Lck » Lck Proteins » Lck Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Lck Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Lck Recombinant Protein Antigen (NBP1-85804PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Lck Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LCK.

Source: E. coli

Amino Acid Sequence: MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLEPEPWFFKNLSRKDAERQLLAPGNTHGS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LCK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85804.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Lck Recombinant Protein Antigen

  • EC 2.7.10
  • EC 2.7.10.2
  • Hck-3
  • Lck
  • Lcktkr
  • Leukocyte C-terminal Src kinase
  • LSK
  • LSTRA
  • Lymphocyte cell-specific protein-tyrosine kinase
  • lymphocyte-specific protein tyrosine kinase
  • p56(LSTRA) protein-tyrosine kinase
  • p56lck
  • p56-LCK
  • pp58lck
  • Protein YT16
  • Proto-oncogene Lck
  • proto-oncogene tyrosine-protein kinase LCK
  • T cell-specific protein-tyrosine kinase
  • T-lymphocyte specific protein tyrosine kinase p56lck
  • tyrosine-protein kinase Lck
  • YT16

Background

The human T-cell or lymphocyte specific gene Lck/p56 is a member of the Src family of non-receptors tyrosine kinase. Mostly expressed in T cells, Lck has been shown to be critical for the normal development of T lymphocytes (1). Additionally, the N-terminal region of the tyrosine kinase Lck interacts with the cytoplasmic domains of CD4 and CD8 (2). Autophosphorylation at Tyr-394 appears to be required for maximum catalytic activity (3) but it can also be suppressed by phosphorylation of the carboxyl-terminal tyrosine Tyr-505 (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
ZAP70 Antibody
NBP1-87000
Western Blot ZAP70 Antibody
Immunohistochemistry-Paraffin ZAP70 Antibody
Immunohistochemistry-Paraffin ZAP70 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
Fyn Antibody
(FYN-01) - BSA Free
NB500-517
Immunoprecipitation Fyn Antibody (FYN-01) - BSA Free
Immunocytochemistry/ Immunofluorescence Fyn Antibody (FYN-01) - BSA Free
Immunocytochemistry/ Immunofluorescence Fyn Antibody (FYN-01) - BSA Free
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
CD3 Antibody (SP7)
NB600-1441
Immunohistochemistry-Frozen CD3 Antibody (SP7)
Immunohistochemistry-Paraffin CD3 Antibody (SP7)
Immunohistochemistry-Paraffin CD3 Antibody (SP7)
(3 Reviews)
(45 Publications)
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
CD8 Antibody
(53-6.7) - BSA Free
NBP1-49045
Immunohistochemistry-Paraffin CD8 Antibody (53-6.7) - BSA Free
Immunocytochemistry/ Immunofluorescence CD8 Antibody (53-6.7) - BSA Free
Immunohistochemistry-Frozen CD8 Antibody (53-6.7) - BSA Free
(3 Reviews)
(28 Publications)
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
CD45 Antibody
[Unconjugated]
AF114
Immunohistochemistry CD45 Antibody [Unconjugated]
Immunocytochemistry CD45 Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence CD45 Antibody [Unconjugated]
(1 Review)
(70 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
PYK2/FAK2 [p
Tyr402] Antibody (592 ...
MAB6210
Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
(1 Review)
(1 Publication)
Species: Hu
Applications: Simple Western, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
CDKL2 Antibody
(OTI12C2)
NBP2-46218
Immunohistochemistry CDKL2 Antibody (OTI12C2)
Immunohistochemistry CDKL2 Antibody (OTI12C2)
Immunohistochemistry CDKL2 Antibody (OTI12C2)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
IFIT1 Antibody
(OTI3G8)
NBP2-02340
Western Blot IFIT1 Antibody (OTI3G8)
Flow Cytometry IFIT1 Antibody (OTI3G8)
Western Blot IFIT1 Antibody (OTI3G8)
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
CCDC91 Antibody
NBP1-84084
Immunohistochemistry-Paraffin CCDC91 Antibody
Immunocytochemistry/ Immunofluorescence CCDC91 Antibody
Western Blot CCDC91 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PSMC1 Antibody
NBP1-80959
Immunohistochemistry-Paraffin PSMC1 Antibody
Immunohistochemistry-Paraffin PSMC1 Antibody
Immunohistochemistry-Paraffin PSMC1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Lyn Antibody
[Unconjugated]
AF3206
Western Blot Lyn Antibody [Unconjugated]
Simple Western Lyn Antibody [Unconjugated]
Immunocytochemistry Lyn Antibody [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
LAT Antibody
NBP2-27104
Western Blot LAT Antibody
Immunohistochemistry-Paraffin LAT Antibody
Species: Hu, Mu, Pm
Applications: IHC, IHC-P, WB
Lck Recombinant
Protein Antigen
NBP1-85804PEP
Lck Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Lck Recombinant Protein Antigen (NBP1-85804PEP) (0)

There are no publications for Lck Recombinant Protein Antigen (NBP1-85804PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lck Recombinant Protein Antigen (NBP1-85804PEP) (0)

There are no reviews for Lck Recombinant Protein Antigen (NBP1-85804PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Lck Recombinant Protein Antigen (NBP1-85804PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Lck Products

Research Areas for Lck Recombinant Protein Antigen (NBP1-85804PEP)

Find related products by research area.

Blogs on Lck

There are no specific blogs for Lck, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

As an alternative, please consider our next generation Recombinant Human IL-2 (BT-002). It has equivalent bioactivity to Recombinant Human IL-2 (Catalog # 202-IL). It combines R&D Systems quality with scalability that allows for a solid supply chain. Both Recombinant Human IL-2 proteins are measured in a cell proliferation assay using CTLL 2 mouse cytotoxic T cells.
IL-2 [Unconjugated]
202-IL-010
CD45 was detected in immersion fixed paraffin-embedded sections of mouse liver using Goat Anti-Mouse CD45 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF114) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to Kupffer cells. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
CD45 Antibody [Unconjugated]
AF114
Immunohistochemistry-Frozen: CD4 Antibody [NBP1-19371] - Staining in mouse liver tissue.
CD4 Antibody - BSA Free
NBP1-19371

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Lck Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol LCK