Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDG |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | LAT |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100. |
||
Control Peptide |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for LAT Antibody (NBP1-81324)Find related products by research area.
|
Cluster of Differentiation 3 (CD3) (OKT3 clone) as a Marker of Immune Response Efficiency Our immune system is a powerful defense mechanism against infection, however different variables can cause our immune response to work for or against us. CD3 (cluster of differentiation 3) is one component of our immune signal response that is co... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | LAT |