Novus Biologicals products are now on bio-techne.com

Laminin beta 3 Recombinant Protein Antigen

Images

 
There are currently no images for Laminin beta 3 Recombinant Protein Antigen (NBP3-21221PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Laminin beta 3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Laminin beta 3

Source: E.coli

Amino Acid Sequence: KLVTSMTKQLGDFWTRMEELRHQARQQGAEAVQAQQLAEGASEQALSAQEGFERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAIMLRSADLTGLEKRVEQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LAMB3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21221. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Laminin beta 3 Recombinant Protein Antigen

  • BM600-125kDa
  • Epiligrin subunit bata
  • FLJ99565
  • Kalinin B1 chain
  • Kalinin subunit beta
  • kalinin-140kDa
  • LAM5
  • Laminin 5
  • Laminin B1k chain
  • laminin S B3 chain
  • laminin subunit beta-3
  • laminin, beta 3 (nicein (125kD), kalinin (140kD), BM600 (125kD))
  • laminin, beta 3
  • Laminin-5 subunit beta
  • LAMNB1
  • Nicein subunit beta
  • nicein-125kDa

Background

The product encoded by this gene is a laminin that belongs to a family of basement membrane proteins. This protein is a beta subunit laminin, which together with an alpha and a gamma subunit, forms laminin-5. Mutations in this gene cause epidermolysis bullosa junctional Herlitz type, and generalized atrophic benign epidermolysis bullosa, diseases that are characterized by blistering of the skin. Multiple alternatively spliced transcript variants that encode the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-42388
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
MAB21441
Species: Hu
Applications: ICC, IHC, IP, ICFlow, WB
NBP2-67316
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP3-07751
Species: Bv, Eq, Gt, Gp, Hu, Sh
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30604
Species: Hu
Applications: IHC, IHC-P
NBP2-34270
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western
AF482
Species: Mu
Applications: IHC, WB
1635-T2
Species: Hu
Applications: BA
DTSP10
Species: Hu
Applications: ELISA
NBP1-86061
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14214
Species: Hu
Applications: IHC, IHC-P
NBP2-59451
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-90312
Species: Hu
Applications: IHC, IHC-P
NBP3-21221PEP
Species: Hu
Applications: AC

Publications for Laminin beta 3 Recombinant Protein Antigen (NBP3-21221PEP) (0)

There are no publications for Laminin beta 3 Recombinant Protein Antigen (NBP3-21221PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Laminin beta 3 Recombinant Protein Antigen (NBP3-21221PEP) (0)

There are no reviews for Laminin beta 3 Recombinant Protein Antigen (NBP3-21221PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Laminin beta 3 Recombinant Protein Antigen (NBP3-21221PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Laminin beta 3 Products

Blogs on Laminin beta 3

There are no specific blogs for Laminin beta 3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Laminin beta 3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMB3