I'm looking for human lamin antibodies that might cross react with Drosophila lamins. I've found a few that I'm interested in, one of which comes in a smaller sample size. The other two do not have a smaller size ordering option. I was wondering if it would be possible to get these other antibodies in a smaller size as well, so we can test reactivity with Drosophila lamins before ordering the full-sized product?

Name: Lamin B2 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-49368PEP
Price: 279 USD

Question

Accepted Answer

We have a wide range of antibodies to human Lamin. Unfortunately none of these has yet been tested against Drosophila samples, however you may be interested in our Innovator's Reward Program. This allows you to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply complete an online review with an image, detailing the positive or negative results of your study, and in return you receive a discount voucher for 100% of the purchase price of the reviewed product. We are unable to offer free samples of our antibodies but, as you rightly point out, some are available as smaller, sample size aliquots. If a sample size is not listed for a product I am afraid we are unable to offer a smaller aliquot than those already listed.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	HuSpecies Glossary
Applications	AC

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Lamin B2. Source: E. coli Amino Acid Sequence: PSTLVWKGQSSWGTGESFRTVLVNADGEEVAMRTVKKSSVMRENENGEEEEE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	LMNB2
Purity	>80% by SDS-PAGE and Coomassie blue staining

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49368. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking tide related information and a protocol, click here.
Theoretical MW	23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Lamin B2 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

Lamin B2 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for Lamin B2 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Lamin B2 Recombinant Protein Antigen (NBP2-49368PEP) (0)

Reviews for Lamin B2 Recombinant Protein Antigen (NBP2-49368PEP) (0)

FAQs for Lamin B2 Recombinant Protein Antigen (NBP2-49368PEP). (Showing 1 - 1 of 1 FAQ).

Additional Lamin B2 Products

Research Areas for Lamin B2 Recombinant Protein Antigen (NBP2-49368PEP)

Blogs on Lamin B2

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics