![Immunohistochemistry-Paraffin: L1CAM Antibody [NBP1-86544] - Staining in human cerebral cortex and skeletal muscle tissues.. Corresponding L1CAM RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/L1CAM-Antibody-Immunohistochemistry-Paraffin-NBP1-86544-img0006.jpg "Immunohistochemistry-Paraffin: L1CAM Antibody [NBP1-86544] - Staining in human cerebral cortex and skeletal muscle tissues.. Corresponding L1CAM RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ELRTHNLTDLSPHLRYRFQLQATTKEGPGEAIVREGGTMALSGISDFGNISATAGENYSVVSWVPKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDLQPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPPAGFATE |
| Marker | Axon Marker |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | L1CAM |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot NCAM-1/CD56 Antibody [Unconjugated]](https://images.novusbio.com/images2/NCAM1_AF2408_Western_Blot_20725.jpg)
![Simple Western NCAM-1/CD56 Antibody [Unconjugated]](https://images.novusbio.com/images2/NCAM1_AF2408_Simple_Western_20928.jpg)
![Immunocytochemistry NCAM-1/CD56 Antibody [Unconjugated]](https://images.novusbio.com/images2/NCAM1_AF2408_Immunocytochemistry_16574.jpg)
| Publication using NBP1-86544 | Applications | Species |
|---|---|---|
| Jorgensen MM, Baek R, Varming K. Potentials and capabilities of the Extracellular Vesicle (EV) Array. J Extracell Vesicles 2015-01-01 [PMID: 25862471] (Human) | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for L1CAM Antibody (NBP1-86544)Find related products by research area.
|
|
Identifying tumoral and stromal transcriptomes that underlie tumor plasticity and stromal neuroinflammatory response in brain metastasis By Jamshed Arslan, Pharm. D., PhD. Cancers in the brain often come from tumors elsewhere in the body. Several adaptive mechanisms influence brain metastasis, such as blood brain barrier leakage that can be induced by ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | L1CAM |
![Immunohistochemistry-Paraffin: L1CAM Antibody [NBP1-86544] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.](http://images.novusbio.com/fullsize/L1CAM-Antibody-Immunohistochemistry-Paraffin-NBP1-86544-img0008.jpg "Immunohistochemistry-Paraffin: L1CAM Antibody [NBP1-86544] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.")
![Immunohistochemistry-Paraffin: L1CAM Antibody [NBP1-86544] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/L1CAM-Antibody-Immunohistochemistry-Paraffin-NBP1-86544-img0005.jpg "Immunohistochemistry-Paraffin: L1CAM Antibody [NBP1-86544] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: L1CAM Antibody [NBP1-86544] - Staining of human kidney shows moderate membranous positivity in cells in distal tubules.](http://images.novusbio.com/fullsize/L1CAM-Antibody-Immunohistochemistry-Paraffin-NBP1-86544-img0007.jpg "Immunohistochemistry-Paraffin: L1CAM Antibody [NBP1-86544] - Staining of human kidney shows moderate membranous positivity in cells in distal tubules.")
![Immunohistochemistry-Paraffin: L1CAM Antibody [NBP1-86544] - Staining of human colon shows moderate positivity in peripheral nerve / ganglion.](http://images.novusbio.com/fullsize/L1CAM-Antibody-Immunohistochemistry-Paraffin-NBP1-86544-img0009.jpg "Immunohistochemistry-Paraffin: L1CAM Antibody [NBP1-86544] - Staining of human colon shows moderate positivity in peripheral nerve / ganglion.")
![Western Blot CD47 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD47_AF4670_Western_Blot_15788.jpg)
![Neutralization CD47 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD47_AF4670_Block_Neutralize_11560.jpg)
![Immunohistochemistry CD47 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD47_AF4670_Immunohistochemistry_6841.jpg)
![Western Blot Protein S/PROS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protein_S_AF4036_Western_Blot_17082.jpg)
![Simple Western Protein S/PROS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protein_S_AF4036_Simple_Western_18689.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_729.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_730.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/Kallikrein_3_DKK300_ELISA_124.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")