Novus Biologicals products are now on bio-techne.com

Kindlin Recombinant Protein Antigen

Images

 
There are currently no images for Kindlin Protein (NBP1-89883PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Kindlin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FERMT1.

Source: E. coli

Amino Acid Sequence: ADSLLEDITDIPKLADNLKLFRPKKLLPKAFKQYWFIFKDTSIAYFKNKELEQGEPL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FERMT1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89883.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kindlin Recombinant Protein Antigen

  • C20orf42fermitin family homolog 1
  • chromosome 20 open reading frame 42
  • fermitin family homolog 1 (Drosophila)
  • fermitin family member 1
  • FLJ20116
  • KIND1DTGCU2
  • kindlerin
  • kindlin 1
  • Kindlin syndrome protein
  • Kindlin-1
  • UNC112 related protein 1
  • UNC112A
  • Unc-112-related protein 1
  • URP1FLJ23423

Background

Due to a concerted effort to identify biomarkers for lung and colon carcinomas by genome-wide transcriptional profiling, the identification and cloning of one such gene as well as two additional closely related genes was achieved. Due to the strong sequence homology to the C. elegans UNC-112 a novel gene gene was named URP1, for UNC-112 related protein. Another novel related gene, URP2 and the previously discovered MIG-2 gene was also identified. Transcriptional analysis shows that only URP1 is significantly differentially regulated, being over-expressed in 70% of the colon carcinomas and 60% of the lung carcinomas tested. Quantification of URP1 expression by qRT-PCR showed up-regulation of the gene by 60-fold in lung tumors and up to nearly 6-fold in colon tumors. Northern blot analysis of URP1 indicates that normal expression is restricted to neuromuscular tissues. In contrast, the expression of URP2 appears to be confined primarily to tissues of the immune system. URP1 has the potential to be one of the most important prognostic and diagnostic markers of colon or lung cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45641
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-47745
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-86665
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-84732
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
DNST0
Species: Hu
Applications: ELISA
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
H00005962-M06
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP2-32875
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NB100-1343
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-16396
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-P, WB
NBP2-94140
Species: Hu, Mu
Applications: WB
NBP2-45727
Species: Hu, Pm, Mu, Rt
Applications: IHC, WB
NBP1-81664
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-48615
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-48817
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80652
Species: Hu
Applications: IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-13252
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84843
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89883PEP
Species: Hu
Applications: AC

Publications for Kindlin Protein (NBP1-89883PEP) (0)

There are no publications for Kindlin Protein (NBP1-89883PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kindlin Protein (NBP1-89883PEP) (0)

There are no reviews for Kindlin Protein (NBP1-89883PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Kindlin Protein (NBP1-89883PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kindlin Products

Blogs on Kindlin

There are no specific blogs for Kindlin, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kindlin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FERMT1