![Western Blot: Kallikrein 14 Antibody [H00043847-B01P] - Analysis of KLK14 expression in transfected 293T cell line by KLK14 polyclonal antibody. Lane 1: KLK14 transfected lysate(27.61 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Kallikrein-14-Antibody-Western-Blot-H00043847-B01P-img0001.jpg "Western Blot: Kallikrein 14 Antibody [H00043847-B01P] - Analysis of KLK14 expression in transfected 293T cell line by KLK14 polyclonal antibody. Lane 1: KLK14 transfected lysate(27.61 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | KLK14 (ENSP00000156499, 1 a.a. - 251 a.a.) full-length human protein. MFLLLTALQVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAALLAGPRRRFLCGGALLSGQWVITAAHCGRPILQVALGKHNLRRWEATQQVLRVVRQVTHPNYNSRTHDNDLMLLQLQQPARIGRAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPASLQCVNINISPDEVCQKAYPRTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKYRSWIEETMRDK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | KLK14 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Kallikrein 14 Antibody (H00043847-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KLK14 |
| Uniprot |
|
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_729.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_730.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/Kallikrein_3_DKK300_ELISA_124.jpg)
![Kallikrein 1 Antibody (323803) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Kallikrein 1 Antibody (323803) [Unconjugated]")
![Enzyme Activity Kallikrein 5 [Unconjugated]](https://images.novusbio.com/images2/Kallikrein_5_1108SE_1835.jpg)
![Western Blot Kallikrein 7 Antibody [Unconjugated]](https://images.novusbio.com/images2/Kallikrein_7_AF2624_Western_Blot_21474.jpg)
![Immunohistochemistry Kallikrein 7 Antibody [Unconjugated]](https://images.novusbio.com/images2/Kallikrein_7_AF2624_Immunohistochemistry_6755.jpg)
![Immunohistochemistry Kallikrein 11 Antibody [Unconjugated]](https://images.novusbio.com/images2/Kallikrein_11_AF1595_Immunohistochemistry_9754.jpg)
![Western Blot Protein S/PROS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protein_S_AF4036_Western_Blot_17082.jpg)
![Simple Western Protein S/PROS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protein_S_AF4036_Simple_Western_18689.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")