Reactivity | HuSpecies Glossary |
Applications | WB, ELISA, MA, PAGE, AP |
Description | A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-70 of Human ERN1 Source: Wheat Germ (in vitro) Amino Acid Sequence: MPARRLLLLLTLLLPGLGVSDRGAWGGGQLATAGSGPGQRRGAGAGVRAGSATAAARCPVSPAVGGSGRA |
Preparation Method |
in vitro wheat germ expression system |
Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
Source | Wheat germ |
Protein/Peptide Type | Recombinant Protein |
Gene | ERN1 |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Dilutions |
|
Theoretical MW | 33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at -80C. Avoid freeze-thaw cycles. |
Buffer | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Preservative | No Preservative |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for IRE1 alpha Recombinant Protein (H00002081-P01)Find related products by research area.
|
Analysis of Total & pSer724 IRE1 alpha, the Sensor of ER Stress Inositol-requiring protein 1/IRE1 alpha (also called Endoplasmic Reticulum to Nucleus Signaling 1/ERN1; predicted mol wt 110 kDa) is a serine-threonine protein kinase/endoribonuclease which plays a highly critical role in unfolded protein response/U... Read full blog post. |
IRE1 alpha dependent apoptotic-signaling pathway Despite in depth characterization of the role of IRE1 alpha (inositol-requiring enzyme 1 alpha) in activating the unfolded protein response (UPR) in the ER - little is known about the molecular mechanisms by which this ER protein has shown to reg... Read full blog post. |
IRE1 alpha (inositol-requiring enzyme 1 alpha) The unfolded protein response (UPR) is a eukaryotic cell process that addresses ER stress. UPR is initiated by three ER-localized sensors: PKR-like ER kinase (PERK), activating transcription factor 6 (ATF6), and inositol-requiring enzyme 1 alpha (... Read full blog post. |
IRE1 alpha and ER Stress: Keys to Disease Progression Pathways Inositol Requiring Enzyme 1 alpha (IRE1 alpha) is a transmembrane-RNase with an endoplasmic reticulum (ER) luminal sensor domain and cytosolic kinase and ribonuclease domains. IRE1 also plays a central role in the ER stress response (1). In a recent s... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | ERN1 |