Novus Biologicals products are now on bio-techne.com

Recombinant Human IRE1 alpha GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human IRE1 alpha Protein [H00002081-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Recombinant Human IRE1 alpha GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-70 of Human ERN1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MPARRLLLLLTLLLPGLGVSDRGAWGGGQLATAGSGPGQRRGAGAGVRAGSATAAARCPVSPAVGGSGRA

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ERN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IRE1 alpha GST (N-Term) Protein

  • EC 2.7.11
  • endoplasmic reticulum to nucleus signaling 1
  • Endoplasmic reticulum-to-nucleus signaling 1
  • ER to nucleus signalling 1
  • ERN1
  • FLJ30999
  • hIRE1p
  • inositol-requiring 1
  • Inositol-requiring protein 1
  • IRE 1a
  • IRE1 alpha
  • IRE1
  • IRE1a
  • Ire1-alpha
  • IRE1MGC163279
  • IRE1P
  • MGC163277
  • protein kinase/endoribonuclease
  • serine/threonine-protein kinase/endoribonuclease IRE1

Background

Accumulation of misfolded proteins in the endoplasmic reticulum (ER) activates the unfolded protein response (UPR) and upregulates ER molecular chaperones in order to cope with ER stress. UPR is initiated by three ER-localized protein sensors: PERK (PKR-like ER kinase), ATF (activating transcription factor 6), and IRE1 alpha (inositol-requiring enzyme 1 alpha) (1). IRE1 alpha is correlated with X-box binding protein (XBP1) as a potent UPR transcriptional activator (2).

Transcriptional activation of UPR-responsive genes are regulated by the ATF6 and IRE1-XBP1 pathways, which are often regulated by HIFs and contribute to cell survival under ER hypoxic stress (3). UPR signaling can a) inhibit protein translation to restore cell function, b) activate signaling to increase production of molecular chaperones for protein folding, and c) initiate ubiquitination signaling that leads to degradation of misfolded proteins in ER.

IRE1 alpha acts as the sensor of unfolded proteins in the ER. IRE1 alpha not only promotes cell survival but can initiate apoptosis when accumulation of unfolded proteins in the ER causes stress. IRE1 alpha is essential for viability under stress conditions that cause unfolded proteins to accumulate in the ER. IRE1 alpha is a transmembrane protein that has both serine-threonine kinase and endoribonuclease activities and has a theoretical molecular weight of 110 kDa. When detecting phospho-IRE1 alpha, it is recommended to normalize its band intensity with total IRE1 alpha.

References

1. Zheng, W., Xie, W., Yin, D., Luo, R., Liu, M., & Guo, F. (2019). ATG5 and ATG7 induced autophagy interplays with UPR via PERK signaling. Cell Commun Signal, 17(1), 42. doi:10.1186/s12964-019-0353-3

2. Cho, Y. M., Kim, D. H., Lee, K. H., Jeong, S. W., & Kwon, O. J. (2018). The IRE1alpha-XBP1s pathway promotes insulin-stimulated glucose uptake in adipocytes by increasing PPARgamma activity. Exp Mol Med, 50(8), 102. doi:10.1038/s12276-018-0131-0

3. Xia, Z., Wu, S., Wei, X., Liao, Y., Yi, P., Liu, Y., . . . Liu, J. (2019). Hypoxic ER stress suppresses beta-catenin expression and promotes cooperation between the transcription factors XBP1 and HIF1alpha for cell survival. J Biol Chem, 294(37), 13811-13821. doi:10.1074/jbc.RA119.008353

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-40256
Species: Hu, Mu, Pl, Po, Rb, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
NBP1-77681
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
AF3999
Species: Hu
Applications: KO, WB
NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NBP3-17487
Species: Hu
Applications: IHC, IHC-P
AF1543
Species: Hu
Applications: IHC, WB
NB100-2494
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NB100-852
Species: Hu, Mu
Applications: PEP-ELISA, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB300-619
Species: Bv, Ch, Ha, Hu, Mu, Rt
Applications: ICC, ICC/IF, IHC, IHC-P, IP, WB
NB100-56077
Species: Hu
Applications: IHC, IHC-P, IP, WB
H00002081-P01
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for IRE1 alpha Recombinant Protein (H00002081-P01) (0)

There are no publications for IRE1 alpha Recombinant Protein (H00002081-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRE1 alpha Recombinant Protein (H00002081-P01) (0)

There are no reviews for IRE1 alpha Recombinant Protein (H00002081-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IRE1 alpha Recombinant Protein (H00002081-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IRE1 alpha Products

Research Areas for IRE1 alpha Recombinant Protein (H00002081-P01)

Find related products by research area.

Blogs on IRE1 alpha.

Analysis of Total & pSer724 IRE1 alpha, the Sensor of ER Stress
Inositol-requiring protein 1/IRE1 alpha (also called Endoplasmic Reticulum to Nucleus Signaling 1/ERN1; predicted mol wt 110 kDa) is a serine-threonine protein kinase/endoribonuclease which plays a highly critical role in unfolded protein response/U...  Read full blog post.

IRE1 alpha dependent apoptotic-signaling pathway
Despite in depth characterization of the role of IRE1 alpha (inositol-requiring enzyme 1 alpha) in activating the unfolded protein response (UPR) in the ER - little is known about the molecular mechanisms by which this ER protein has shown to reg...  Read full blog post.

IRE1 alpha (inositol-requiring enzyme 1 alpha)
The unfolded protein response (UPR) is a eukaryotic cell process that addresses ER stress. UPR is initiated by three ER-localized sensors: PKR-like ER kinase (PERK), activating transcription factor 6 (ATF6), and inositol-requiring enzyme 1 alpha (...  Read full blog post.

IRE1 alpha and ER Stress: Keys to Disease Progression Pathways
Inositol Requiring Enzyme 1 alpha (IRE1 alpha) is a transmembrane-RNase with an endoplasmic reticulum (ER) luminal sensor domain and cytosolic kinase and ribonuclease domains. IRE1 also plays a central role in the ER stress response (1). In a recent s...  Read full blog post.

mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IRE1 alpha GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ERN1