IP3R3 Antibody (9D3H2) Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1630-1870 of human IP3R3 (NP_002215.2).
Sequence: EGSEAYQRCESGGFLSKLIQHTKDLMESEEKLCIKVLRTLQQMLLKKTKYGDRGNQLRKMLLQNYLQNRKSTSRGDLPDPIGTGLDPDWSAIAATQCRLDKEGATKLVCDLITSTKNEKIFQESIGLAIHLLDGGNTEIQKSFHNLMMSDKKSERFFKVLHDRMKRAQQETKSTVAVNMNDLGSQPHEDREPVDPTTKGRVASFSIPGSSSRYSLGPSLRRGHEVSERVQSSEMGTSVLIM |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
ITPR3 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA Recommended starting concentration is 1 ug/mL
- Western Blot 1:2000 - 1:6000
|
Theoretical MW |
304 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
Preservative |
0.05% Proclin 300 |
Purity |
Affinity purified |
Alternate Names for IP3R3 Antibody (9D3H2)
Background
IP3R3 (inositol 1,4,5-triphosphate receptor type 3) is an intracellular calcium release channel that mediates calcium release from the endoplasmic reticulum. There are 3 mammalian IP3R receptors: IP3R1, IP3R2, and IP3R3. IP3R3 has been shown to play a role in olfactory mucus secretion and in the taste perception of sweet, savory (umami), and bitter substances.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P
Species: Am, Bv, Ca, Ma, Fi, Hu, Ma-Mn, Mu, Pm, Rb, Rt, Sh
Applications: B/N, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Publications for IP3R3 Antibody (NBP3-33409) (0)
There are no publications for IP3R3 Antibody (NBP3-33409).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IP3R3 Antibody (NBP3-33409) (0)
There are no reviews for IP3R3 Antibody (NBP3-33409).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for IP3R3 Antibody (NBP3-33409) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IP3R3 Products
Research Areas for IP3R3 Antibody (NBP3-33409)
Find related products by research area.
|
Blogs on IP3R3