Home » IL-10R alpha » IL-10R alpha Proteins » IL-10R alpha Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

IL-10R alpha Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for IL-10R alpha Recombinant Protein Antigen (NBP3-21308PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

IL-10R alpha Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL-10R alpha

Source: E.coli

Amino Acid Sequence: SVLLFKKPSPFIFISQRPSPETQDTIHPLDEEAFLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IL10RA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21308. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IL-10R alpha Recombinant Protein Antigen

  • CD210 antigen
  • CDw210a
  • HIL-10R
  • IBD28
  • IL-10 R alpha
  • IL-10 receptor subunit alpha
  • IL10R alpha
  • IL-10R subunit 1
  • IL-10R1
  • IL10RA
  • IL-10Ra
  • IL10RIL-10R subunit alpha
  • interleukin 10 receptor, alpha
  • interleukin-10 receptor alpha chain
  • Interleukin-10 receptor subunit 1
  • interleukin-10 receptor subunit alpha

Background

The IL-10 receptor, IL-10R, is a member of the class II subgroup of the cytokine receptor family and exhibits structural similarity to the interferon receptor. IL-10R is expressed in B cells and T helper cells, as well as in LPS-induced mouse fibroblasts. Overall, mouse IL-10R and human IL-10R share 60% sequence identity at the protein level. Stimulation with IL-10 leads to tyrosine phosphorylation of JAK1 and Tyk2, but not JAK2 or JAK3. In addition to its role as an antagonist of IFN-gamma-mediated macrophage activation, IL-10Ralpha transmits differentiation as well as proliferative signals. IL-10R is constitutively expressed on human natural killer (NK) cells and the direct binding of IL-10 potentiates cytokine production by human NK cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(301 Publications)
Species: Mu
Applications: ELISA
IL-10 R beta
Antibody (90220) [Unc ...
MAB874
Neutralization IL-10 R beta Antibody (90220) [Unconjugated]
Flow Cytometry IL-10 R beta Antibody (90220) [Unconjugated]
(1 Review)
(9 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
STAT3 Antibody
(232209) [Unconjugate
MAB1799
Knockout Validated STAT3 Antibody (232209) [Unconjugated]
Western Blot STAT3 Antibody (232209) [Unconjugated]
Knockout Validated STAT3 Antibody (232209) [Unconjugated]
(22 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
IL-22
[Unconjugated]
782-IL/CF
SDS-PAGE IL-22 [Unconjugated]
Bioactivity IL-22 [Unconjugated]
(65 Publications)
Species: Hu
Applications: BA
SOCS-3 Antibody
(516919) [Unconjugate
MAB5696
Western Blot SOCS-3 Antibody (516919) [Unconjugated]
(6 Publications)
Species: Hu, Mu
Applications: WB
IL-17D Antibody
(246018) [Unconjugate
MAB15041
Immunohistochemistry IL-17D Antibody (246018) [Unconjugated]
Intracellular Staining by Flow Cytometry IL-17D Antibody (246018) [Unconjugated]
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(661 Publications)
Species: Mu
Applications: ELISA
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(452 Publications)
Species: Hu
Applications: BA
STAT1 [p Tyr701]
Antibody [Unconjugate ...
AF2894
Western Blot STAT1 [p Tyr701] Antibody [Unconjugated]
Simple Western STAT1 [p Tyr701] Antibody [Unconjugated]
Intracellular Staining by Flow Cytometry STAT1 [p Tyr701] Antibody [Unconjugated]
(1 Review)
(11 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
IL-1 beta/IL-1F2
[Unconjugated]
201-LB
SDS-PAGE IL-1 beta/IL-1F2 [Unconjugated]
Bioactivity IL-1 beta/IL-1F2 [Unconjugated]
SEC-MALS IL-1 beta/IL-1F2 [Unconjugated]
(594 Publications)
Species: Hu
Applications: BA
IL-17B Antibody
[Unconjugated]
AF1709
Intracellular Staining by Flow Cytometry IL-17B Antibody [Unconjugated]
(2 Publications)
Species: Mu
Applications: Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICFlow, WB
IL-20
[Unconjugated]
1102-IL/CF
IL-20 [Unconjugated]
(11 Publications)
Species: Hu
Applications: BA
IL-26/AK155
Antibody
AF1375
IL-26/AK155 Antibody
(6 Publications)
Species: Hu
Applications: WB
IL-17F [Biotin]
DY1335B
N/A IL-17F [Biotin]
N/A IL-17F [Biotin]
(13 Publications)
Species: Hu
Applications: ELISA
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

IL-1ra/IL-1F3/IL1RN [H
DRA00B
N/A IL-1ra/IL-1F3/IL1RN [HRP]
N/A IL-1ra/IL-1F3/IL1RN [HRP]
N/A IL-1ra/IL-1F3/IL1RN [HRP]
(100 Publications)
Species: Hu
Applications: ELISA
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA

Publications for IL-10R alpha Recombinant Protein Antigen (NBP3-21308PEP) (0)

There are no publications for IL-10R alpha Recombinant Protein Antigen (NBP3-21308PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-10R alpha Recombinant Protein Antigen (NBP3-21308PEP) (0)

There are no reviews for IL-10R alpha Recombinant Protein Antigen (NBP3-21308PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IL-10R alpha Recombinant Protein Antigen (NBP3-21308PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-10R alpha Products

Research Areas for IL-10R alpha Recombinant Protein Antigen (NBP3-21308PEP)

Find related products by research area.

Blogs on IL-10R alpha

There are no specific blogs for IL-10R alpha, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IL-10R alpha Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol IL10RA