![Western Blot: IFN-alpha H2/IFNA14 Antibody [H00003448-D01P] - Analysis of IFNA14 expression in transfected 293T cell line by IFNA14 polyclonal antibody.Lane 1: IFNA14 transfected lysate(22.10 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/IFN-alpha-H2-IFNA14-Antibody-Western-Blot-H00003448-D01P-img0002.jpg "Western Blot: IFN-alpha H2/IFNA14 Antibody [H00003448-D01P] - Analysis of IFNA14 expression in transfected 293T cell line by IFNA14 polyclonal antibody.Lane 1: IFNA14 transfected lysate(22.10 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | IFNA14 (AAH74956.1, 1 a.a. - 189 a.a.) full-length human protein. MALPFALMMALVVLSCKSSCSLGCNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD |
| Specificity | Reacts with interferon, alpha 14. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IFNA14 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for IFN-alpha H2/IFNA14 Antibody (H00003448-D01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | IFNA14 |
| Entrez |
|
| Uniprot |
|
![Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/CBP_MAB2676_Western_Blot_6043.jpg)
![Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/mab2676_human-mouse-rat-cbp-mab-clone-257003-immunocytochemistry-101220208237.jpg)
![Binding Activity IFN-beta [Unconjugated]](https://images.novusbio.com/images2/IFNbeta_8499IF_1038.jpg)
![IFN-alpha C/IFN-alpha 10 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "IFN-alpha C/IFN-alpha 10 [Unconjugated]")
![Simple Western PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Simple_Western_16616.jpg)
![Western Blot PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Western_Blot_9455.jpg)
![Western Blot eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Western-Blot-NB100-81898-img0009.jpg)
![Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunocytochemistry-Immunofluorescence-NB100-81898-img0005.jpg)
![Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunohistochemistry-NB100-81898-img0006.jpg)
![Immunohistochemistry Podocalyxin Like Antibody [Unconjugated]](https://images.novusbio.com/images2/Podocalyxin_AF1556_Immunohistochemistry_11445.jpg)
![Western Blot Podocalyxin Like Antibody [Unconjugated]](https://images.novusbio.com/images2/Podocalyxin_AF1556_Western_Blot_12581.jpg)
![Immunocytochemistry/ Immunofluorescence Podocalyxin Like Antibody [Unconjugated]](https://images.novusbio.com/images/af1556_mouse-podocalyxin-affinity-purified-polyclonal-ab-41202410485429.jpg)
![Western Blot MuRF1/TRIM63 Antibody [Unconjugated]](https://images.novusbio.com/images2/MuRF1_AF5366_Western_Blot_5701.jpg)
![Simple Western MuRF1/TRIM63 Antibody [Unconjugated]](https://images.novusbio.com/images2/MuRF1_AF5366_Simple_Western_17120.jpg)
![Western Blot MuRF1/TRIM63 Antibody [Unconjugated]](https://images.novusbio.com/images/af5366_human-mouse-rat-murf1-trim63-affinity-purified-polyclonal-ab-41202412402520.jpg)
![N/A CCL5/RANTES [HRP]](https://images.novusbio.com/images2/CCL5_DRN00_ELISA_393.jpg)
![N/A CCL5/RANTES [HRP]](https://images.novusbio.com/images2/DATA_CCL5_DRN00_ELISA_810.jpg)
![N/A CCL5/RANTES [HRP]](https://images.novusbio.com/images2/DATA_CCL5_DRN00_ELISA_811.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")