Home » IA-2/PTPRN » IA-2 Peptides and Proteins » IA-2/PTPRN Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

IA-2/PTPRN Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for IA-2/PTPRN Protein (NBP1-83128PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

IA-2/PTPRN Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PTPRN.

Source: E. coli

Amino Acid Sequence: HSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTLLTLLQLLPKGA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PTPRN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83128.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IA-2/PTPRN Recombinant Protein Antigen

  • CA 512
  • EC 3.1.3.48
  • FLJ16131
  • IA2
  • IA-2
  • IA-2/PTP
  • ICA 512
  • ICA3
  • ICA512
  • islet cell antigen 2
  • Islet cell antigen 512
  • Islet cell autoantigen 3
  • protein tyrosine phosphatase, receptor type, N
  • protein tyrosine phosphatase-like N
  • PTP IA-2
  • PTPRN
  • receptor-type tyrosine-protein phosphatase-like N
  • R-PTP-N

Background

PTPRN is encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single catalytic domain, and thus represents a receptor-type PTP. This PTP was found to be an autoantigen that is reactive with insulin-dependent diabetes mellitus (IDDM) patient sera, and thus may be a potential target of autoimmunity in diabetes mellitus. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Glutamine
Synthetase Antibody
NB110-41404
Immunocytochemistry/ Immunofluorescence Glutamine Synthetase Antibody
Western Blot Glutamine Synthetase Antibody
Immunohistochemistry Glutamine Synthetase Antibody
(1 Review)
(11 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
GAD2/GAD65
Antibody [Unconjugate
AF2247
Immunohistochemistry GAD2/GAD65 Antibody [Unconjugated]
(1 Review)
(4 Publications)
Species: Hu
Applications: IHC, WB
GAD1/GAD67
Antibody [Unconjugate
AF2086
Immunohistochemistry GAD1/GAD67 Antibody [Unconjugated]
Western Blot GAD1/GAD67 Antibody [Unconjugated]
Simple Western GAD1/GAD67 Antibody [Unconjugated]
(13 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
PTPRN2 Antibody
NBP3-35468
Western Blot PTPRN2 Antibody
Immunohistochemistry PTPRN2 Antibody
Immunohistochemistry PTPRN2 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Recombinant Human
HLA DRB4 GST (N-Term) ...
H00003126-P01
Other Recombinant Human HLA DRB4 GST (N-Term) Protein
(1 Publication)
Species: Hu
Applications: ELISA, AP, PA, WB
ZnT-8/SLC30A8
Antibody (815039) [Un ...
MAB7936
Immunohistochemistry ZnT-8/SLC30A8 Antibody (815039) [Unconjugated]
Intracellular Staining by Flow Cytometry ZnT-8/SLC30A8 Antibody (815039) [Unconjugated]
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow
ATN1 Antibody
NBP1-90044
Immunocytochemistry/ Immunofluorescence ATN1 Antibody
Immunohistochemistry-Paraffin ATN1 Antibody
Immunohistochemistry-Paraffin ATN1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SLC30A10 Antibody
NBP2-68817
Immunocytochemistry/ Immunofluorescence SLC30A10 Antibody
Species: Hu
Applications: IHC, IHC-P
LAD1 Antibody
NBP1-86126
Immunohistochemistry-Paraffin LAD1 Antibody
Immunohistochemistry-Paraffin LAD1 Antibody
Immunohistochemistry-Paraffin LAD1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
INSM2 Antibody
(INSM2/4291)
NBP3-07402
Protein Array INSM2 Antibody (INSM2/4291)
Immunohistochemistry-Paraffin INSM2 Antibody (INSM2/4291)
Species: Hu
Applications: IHC-P, PA
SOX13 Antibody
NBP1-32847
Immunoprecipitation SOX13 Antibody
Immunocytochemistry/ Immunofluorescence SOX13 Antibody
Western Blot SOX13 Antibody
Species: Hu
Applications: ICC/IF, IP, WB
PTP pi/PTPRU
Antibody (764209)
MAB7475
Western Blot PTP pi/PTPRU Antibody (764209)
(4 Publications)
Species: Hu, Rt
Applications: WB
Thyroid Peroxidase
Antibody
NBP1-80670
Immunohistochemistry-Paraffin Thyroid Peroxidase Antibody
Immunohistochemistry-Paraffin Thyroid Peroxidase Antibody
Immunohistochemistry-Paraffin Thyroid Peroxidase Antibody
(4 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
INSM1 Antibody -
BSA Free
NBP1-76307
Western Blot INSM1 Antibody - BSA Free
Western Blot INSM1 Antibody - BSA Free
(1 Review)
Species: Hu, Mu, Rt
Applications: ELISA, WB

Publications for IA-2/PTPRN Protein (NBP1-83128PEP) (0)

There are no publications for IA-2/PTPRN Protein (NBP1-83128PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IA-2/PTPRN Protein (NBP1-83128PEP) (0)

There are no reviews for IA-2/PTPRN Protein (NBP1-83128PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IA-2/PTPRN Protein (NBP1-83128PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IA-2/PTPRN Products

Research Areas for IA-2/PTPRN Protein (NBP1-83128PEP)

Find related products by research area.

Blogs on IA-2/PTPRN

There are no specific blogs for IA-2/PTPRN, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IA-2/PTPRN Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PTPRN